Knowledge Summary

Patent

No data available

Synonym

Accession Q8N402
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGIHFSCIRGDLKKPSKKRVKREPYSTTMLQVTSLSPINEILRRYSLYTNQHWRHHGFWRKKIQPQEASE      1 - 70
EPPAHKDRGGGERPVNARVVRVAPLRPGFALCGYAVQDISKEDTVYDICNEDAVDISDEDTVDISNEASV     71 - 140
HDISNEAAVCDISNDAVNISNEAAVRDISNDAVDICNEAAVHDISNEDTIEDISYEDTVYDITNEDAVRY    141 - 210
LCKKDATKEPLTLENDLIVESMSDDEDFAA                                            211 - 240
//

Text Mined References (1)

PMID Year Title