Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $100,333.33
PubMed Score 58.08
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.634 0.000
group 3 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.200 0.012
tuberculosis 1.400 0.000
atypical teratoid/rhabdoid tumor 1.100 0.001

Synonym

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (1)

PMID Text
19586940 Data show that sequences 3' of PAX5 disrupting ASXL1, and ZCCHC7 disrupted by sequences 3' of FRG1B and LOC1499503.

AA Sequence

MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPN      1 - 70
QKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAHGLSSSLQSNELVDKKCKSDIEKP     71 - 140
KSEERSGVIREVMIIEVSSSEEEESTISEGDNVESWMLLGCEVDDKDDDILLNLVGCENSVTEGEDGINW    141 - 210
SISDKDIEAQIANNRTPGRWTQRYYSANKNIICRNCDKRGHLSKNCPLPRKVRRCFLCSRRGHLLYSCPA    211 - 280
PLCEYCPVPKMLDHSCLFRHSWDKQCDRCHMLGHYTDACTEIWRQYHLTTKPGPPKKPKTPSRPSALAYC    281 - 350
YHCAQKGHYGHECPEREVYDPSPVSPFICYYDDKYEIQEREKRLKQKIKVLKKNGVIPEPSKLPYIKAAN    351 - 420
ENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQK    421 - 490
PSKPFHRSSHYHTSREDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQRKKKS                     491 - 543
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22817747 2012 Comparison of the yeast and human nuclear exosome complexes.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21855801 2011 Interaction profiling identifies the human nuclear exosome targeting complex.
19586940 2009 Heterogeneous breakpoints in patients with acute lymphoblastic leukemia and the dic(9;20)(p11-13;q11) show recurrent involvement of genes at 20q11.21.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...