Property Summary

NCBI Gene PubMed Count 12
PubMed Score 60.23
PubTator Score 24.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.0e-03
group 3 medulloblastoma 1.400 9.5e-05
medulloblastoma, large-cell 1.200 1.2e-02
osteosarcoma -1.634 2.6e-04
tuberculosis 1.400 1.5e-06

Gene RIF (2)

AA Sequence

MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPN      1 - 70
QKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAHGLSSSLQSNELVDKKCKSDIEKP     71 - 140
KSEERSGVIREVMIIEVSSSEEEESTISEGDNVESWMLLGCEVDDKDDDILLNLVGCENSVTEGEDGINW    141 - 210
SISDKDIEAQIANNRTPGRWTQRYYSANKNIICRNCDKRGHLSKNCPLPRKVRRCFLCSRRGHLLYSCPA    211 - 280
PLCEYCPVPKMLDHSCLFRHSWDKQCDRCHMLGHYTDACTEIWRQYHLTTKPGPPKKPKTPSRPSALAYC    281 - 350
YHCAQKGHYGHECPEREVYDPSPVSPFICYYDDKYEIQEREKRLKQKIKVLKKNGVIPEPSKLPYIKAAN    351 - 420
ENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQK    421 - 490
PSKPFHRSSHYHTSREDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQRKKKS                     491 - 543
//

Text Mined References (19)

PMID Year Title