Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.31
PubTator Score 1.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hepatomegaly 285 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.7e-14
cystic fibrosis 1696 2.2e-06
tuberculosis 2010 5.5e-05
group 4 medulloblastoma 1855 1.0e-02
medulloblastoma, large-cell 6241 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -3.431 2.2e-06
group 4 medulloblastoma -1.600 1.0e-02
medulloblastoma, large-cell -1.900 1.0e-02
ovarian cancer -3.700 1.7e-14
tuberculosis -1.400 5.5e-05

Synonym

Accession Q8N3Z0 A8K7B3 Q9BQP6
Symbols C6orf158
dJ223E3.1

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MENMLLWLIFFTPGWTLIDGSEMEWDFMWHLRKVPRIVSERTFHLTSPAFEADAKMMVNTVCGIECQKEL      1 - 70
PTPSLSELEDYLSYETVFENGTRTLTRVKVQDLVLEPTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLT     71 - 140
NFPFSTAVKLSTGCSGILISPQHVLTAAHCVHDGKDYVKGSKKLRVGLLKMRNKSGGKKRRGSKRSRREA    141 - 210
SGGDQREGTREHLRERAKGGRRRKKSGRGQRIAEGRPSFQWTRVKNTHIPKGWARGGMGDATLDYDYALL    211 - 280
ELKRAHKKKYMELGISPTIKKMPGGMIHFSGFDNDRADQLVYRFCSVSDESNDLLYQYCDAESGSTGSGV    281 - 350
YLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWIHGNDANCAYG           351 - 413
//

Text Mined References (10)

PMID Year Title