Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.02
PubTator Score 1.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma -1.700 0.002
cystic fibrosis -3.431 0.000
medulloblastoma, large-cell -1.900 0.010
tuberculosis -1.400 0.000
ovarian cancer -3.700 0.000

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20511563 We provide further evidence of the involvement of chromosome 6q in cleft lip/palate and suggest PRSS35 as a novel candidate gene.
20511563 Observational study of gene-disease association. (HuGE Navigator)
16870946 Mouse ortholog of human PRSS35 is an ovary-selectively expressed gene.

AA Sequence

MENMLLWLIFFTPGWTLIDGSEMEWDFMWHLRKVPRIVSERTFHLTSPAFEADAKMMVNTVCGIECQKEL      1 - 70
PTPSLSELEDYLSYETVFENGTRTLTRVKVQDLVLEPTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLT     71 - 140
NFPFSTAVKLSTGCSGILISPQHVLTAAHCVHDGKDYVKGSKKLRVGLLKMRNKSGGKKRRGSKRSRREA    141 - 210
SGGDQREGTREHLRERAKGGRRRKKSGRGQRIAEGRPSFQWTRVKNTHIPKGWARGGMGDATLDYDYALL    211 - 280
ELKRAHKKKYMELGISPTIKKMPGGMIHFSGFDNDRADQLVYRFCSVSDESNDLLYQYCDAESGSTGSGV    281 - 350
YLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWIHGNDANCAYG           351 - 413
//

Text Mined References (10)

PMID Year Title
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
16870946 2006 The identification of novel ovarian proteases through the use of genomic and bioinformatic methodologies.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.