Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.84
PubTator Score 8.17

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count Z-score Confidence
3-M syndrome 16 3.783 1.9



Accession Q8N3Y1 Q9UK95
Symbols FBW6


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

25790475 FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated
24973709 findings will shed light the role to mechanism of miR-218 in regulating JEG-3 cells proliferation via miR-218/Fbxw8 axis, and miR-218 may serve as a novel potential therapeutic target in human choriocarcinoma in the future
24362026 CUL7/Fbxw8 ubiquitin ligase-mediated HPK1 degradation revealed a direct link and novel role of CUL7/Fbxw8 ubiquitin ligase in the MAPK pathway, which plays a critical role in cell proliferation and differentiation.
23029530 Growth factor-stimulated TBC1D3 ubiquitination and degradation are regulated by its interaction with CUL7-Fbw8.
22524683 Dysregulation of Cul7 and Fbxw8 expression might affect trophoblast turnover in intrauterine growth restriction.
20878477 Fbxw8 plays an essential role in the proliferation of human trophoblast cells, especially JEG-3 cells.
17998335 FBXW8-CUL7 complex plays a significant role in growth control
17205132 FBXW8 plays an essential role in cancer cell proliferation through proteolysis of cyclin D1. It may present new opportunities to develop therapies targeting destruction of cyclin D1 or its regulator E3 ligase selectively.

AA Sequence

FAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV                                    561 - 598

Text Mined References (24)

PMID Year Title
25790475 2015 Both ubiquitin ligases FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated.
24973709 2014 MicroRNA-218 inhibits the proliferation of human choriocarcinoma JEG-3 cell line by targeting Fbxw8.
24793695 2014 The 3M complex maintains microtubule and genome integrity.
24362026 2014 The CUL7/F-box and WD repeat domain containing 8 (CUL7/Fbxw8) ubiquitin ligase promotes degradation of hematopoietic progenitor kinase 1.
23029530 2012 Ubiquitination and degradation of the hominoid-specific oncoprotein TBC1D3 is mediated by CUL7 E3 ligase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22524683 2012 Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
22504417 2012 Identification of common variants associated with human hippocampal and intracranial volumes.
21572988 2011 An OBSL1-Cul7Fbxw8 ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning.
20878477 2011 Fbxw8 is involved in the proliferation of human choriocarcinoma JEG-3 cells.