Property Summary

NCBI Gene PubMed Count 24
PubMed Score 24.53
PubTator Score 9.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MDKGRERMAAAAAAAAAAAAAAQCRSPRCAAERRGFRRELDSWRHRLMHCVGFESILEGLYGPRLRRDLS      1 - 70
LFEDCEPEELTDWSMDEKCSFCNLQREAVSDCIPSLDSSQSTPTEELSSQGQSNTDKIECQAENYLNALF     71 - 140
RKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQENRNGSIGPSIVCKSIQMNQAENSLQEEQE    141 - 210
GPLDLTVNRMQEQNTQQGDGVLDLSTKKTSIKSEESSICDPSSENSVAGRLHRNREDYVERSAEFADGLL    211 - 280
SKALKDIQSGALDINKAGILYGIPQKTLLLHLEALPAGKPASFKNKTRDFHDSYSYKDSKETCAVLQKVA    281 - 350
LWARAQAERTEKSKLNLLETSEIKFPTASTYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVS    351 - 420
SVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSVDSYFLHGDLSPLCLN    421 - 490
SKNGTVDGTSENTEDGLDRKDSKQPRKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEY    491 - 560
KVKERSGTLKTPPKKKLRLPDTGLYNMTDSGTGSCKNSSKPV                                561 - 602
//

Text Mined References (28)

PMID Year Title