Property Summary

NCBI Gene PubMed Count 24
PubMed Score 21.81
PubTator Score 9.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
12560079 Identification and characterization of an homologous gene in mouse.

AA Sequence

MDKGRERMAAAAAAAAAAAAAAQCRSPRCAAERRGFRRELDSWRHRLMHCVGFESILEGLYGPRLRRDLS      1 - 70
LFEDCEPEELTDWSMDEKCSFCNLQREAVSDCIPSLDSSQSTPTEELSSQGQSNTDKIECQAENYLNALF     71 - 140
RKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQENRNGSIGPSIVCKSIQMNQAENSLQEEQE    141 - 210
GPLDLTVNRMQEQNTQQGDGVLDLSTKKTSIKSEESSICDPSSENSVAGRLHRNREDYVERSAEFADGLL    211 - 280
SKALKDIQSGALDINKAGILYGIPQKTLLLHLEALPAGKPASFKNKTRDFHDSYSYKDSKETCAVLQKVA    281 - 350
LWARAQAERTEKSKLNLLETSEIKFPTASTYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVS    351 - 420
SVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSVDSYFLHGDLSPLCLN    421 - 490
SKNGTVDGTSENTEDGLDRKDSKQPRKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEY    491 - 560
KVKERSGTLKTPPKKKLRLPDTGLYNMTDSGTGSCKNSSKPV                                561 - 602
//

Text Mined References (27)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
22021425 2012 Genome-wide association study of body height in African Americans: the Women's Health Initiative SNP Health Association Resource (SHARe).
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...