Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.07
PubTator Score 4.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma 1.100 4.0e-02
atypical teratoid / rhabdoid tumor 1.200 2.2e-03
breast carcinoma 1.100 1.8e-02
dermatomyositis 1.200 5.0e-04
ependymoma 1.400 2.7e-03
glioblastoma 1.100 2.2e-02
group 3 medulloblastoma 1.100 1.2e-02
interstitial lung disease 1.200 2.0e-02
intraductal papillary-mucinous adenoma (... 1.500 2.3e-04
intraductal papillary-mucinous carcinoma... 1.200 3.6e-03
lung cancer 1.400 1.1e-03
Multiple myeloma 1.173 2.1e-03
oligodendroglioma 1.300 7.3e-03
osteosarcoma 3.635 2.9e-08
ovarian cancer -1.900 3.2e-08
pancreatic ductal adenocarcinoma liver m... 1.435 4.4e-02
Pick disease -2.500 7.2e-08
pituitary cancer -1.300 8.9e-03
primitive neuroectodermal tumor 1.700 3.5e-04
progressive supranuclear palsy -2.100 6.5e-03
psoriasis -1.200 3.4e-07
Waldenstrons macroglobulinemia 1.062 3.3e-03

Gene RIF (1)

AA Sequence

MGKKSRAVPGRRPILQLSPPGPRGSTPGRDPEPEPDTEPDSTAAVPSQPAPSAATTTTTAVTAAAASDDS      1 - 70
PSEDEQEAVQEVPRVVQNPPKPVMTTRPTAVKATGGLCLLGAYADSDDDDNDVSEKLAQSKETNGNQSTD     71 - 140
IDSTLANFLAEIDAITAPQPAAPVGASAPPPTPPRPEPKEAATSTLSSSTSNGTDSTQTSGWQYDTQCSL    141 - 210
AGVGIEMGDWQEVWDENTGCYYYWNTQTNEVTWELPQYLATQVQGLQHYQPSSVPGAETSFVVNTDIYSK    211 - 280
EKTISVSSSKSGPVIAKREVKKEVNEGIQALSNSEEEKKGVAASLLAPLLPEGIKEEEERWRRKVICKEE    281 - 350
PVSEVKETSTTVEEATTIVKPQEIMLDNIEDPSQEDLCSVVQSGESEEEEEQDTLELELVLERKKAELRA    351 - 420
LEEGDGSVSGSSPRSDISQPASQDGMRRLMSKRGKWKMFVRATSPESTSRSSSKTGRDTPENGETAIGAE    421 - 490
NSEKIDENSDKEMEVEESPEKIKVQTTPKVEEEQDLKFQIGELANTLTSKFEFLGINRQSISNFHVLLLQ    491 - 560
TETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGE    561 - 630
EEEEESQAQENRDETLAKQTLKDKTGTDSNSTESSETSTGSLCKESFSGQVSSSSLMPLTPFWTLLQSNV    631 - 700
PVLQPPLPLEMPPPPPPPPESPPPPPPPPPPAEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPSAQTTVV    701 - 770
TSQSSVDSTISSSSSTKGIKRKATEISTAVVQRSATIGSSPVLYSQSAIATGHQAAGIGNQATGIGHQTI    771 - 840
PVSLPAAGMGHQARGMSLQSNYLGLAAAPAIMSYAECSVPIGVTAPSLQPVQARGAVPTATIIEPPPPPP    841 - 910
PPPPPPPPAPKMPPPEKTKKGRKDKAKKSKTKMPSLVKKWQSIQRELDEEDNSSSSEEDRESTAQKRIEE    911 - 980
WKQQQLVSGMAERNANFEALPEDWRARLKRRKMAPNT                                     981 - 1017
//

Text Mined References (40)

PMID Year Title