Property Summary

NCBI Gene PubMed Count 34
PubMed Score 132.69
PubTator Score 31.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease -1.792 1.1e-02
acute quadriplegic myopathy -1.509 1.2e-07
adult high grade glioma 1.400 3.7e-03
astrocytoma -1.300 4.1e-24
Astrocytoma, Pilocytic 1.200 1.4e-04
atypical teratoid / rhabdoid tumor -2.600 1.1e-10
Breast cancer 1.700 1.0e-02
Duchenne muscular dystrophy -1.088 7.4e-08
ductal carcinoma in situ -1.600 2.7e-03
ependymoma -1.400 1.1e-03
glioblastoma -1.900 3.4e-08
group 3 medulloblastoma -1.600 3.4e-02
intraductal papillary-mucinous carcinoma... -1.500 8.4e-03
invasive ductal carcinoma -2.600 2.0e-03
lung adenocarcinoma -1.500 1.1e-09
lung cancer -1.500 3.8e-05
malignant mesothelioma 1.800 1.1e-07
medulloblastoma, large-cell -2.200 4.5e-04
non-small cell lung cancer -1.404 5.2e-13
oligodendroglioma -1.400 3.1e-20
ovarian cancer -1.200 1.3e-03
primitive neuroectodermal tumor -2.700 4.1e-06
subependymal giant cell astrocytoma 3.275 3.6e-03
ulcerative colitis -1.100 2.3e-06

 GO Function (1)

Gene RIF (20)

AA Sequence

MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSAC      1 - 70
RVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKPALGRSTS     71 - 140
LTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPG    141 - 210
HAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAAL    211 - 280
LTANGLHLSQNREAQQSSPAPPPAEVHSPAADVNQNLASPSATLTTPTSNSSHNPPATDVNQNPPATVVP    281 - 350
QSLPLSSIQQNSSEAQLPSNGTGPASKPSTLCADGQPQAPAEEVRCSTLLIDKVSTPATTTSTFSREATL    351 - 420
IPSSRPPASDFMSSSLLIDIQPNTLVVSADQEMSGRAAATTPTKVYSEVHFTLAKPPSVVNRTARPFGIQ    421 - 490
APGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVERRMMGQRSPASERRPLGNFT    491 - 560
APPTYTETLSTAPLASWVRSPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEK    561 - 630
PKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCL    631 - 700
KSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPSPTMSLPSSWKYPTNAP    701 - 770
GAFRVASRSPARTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL    771 - 840
DLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSPRAKQAPRPSF    841 - 910
STRNAGIEAQVWKPSFCFK                                                       911 - 929
//

Text Mined References (43)

PMID Year Title