Property Summary

NCBI Gene PubMed Count 31
Grant Count 93
R01 Count 69
Funding $7,397,839.86
PubMed Score 123.98
PubTator Score 31.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N3V7 A5PKZ8 D3DQG8 O15271 Q9UPX1
Symbols

Gene

 GO Function (1)

Gene RIF (18)

PMID Text
25613138 The gene expression of synaptopodin is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25295576 Case Report: immunohistologically detected synaptopodin upregulation in foamy podocytes in Fabry disease due to novel alpha-galactosidase A mutation.
25145932 expression significantly down-regulated in presence of WT1 R458Q mutation
25048004 This study identified and confirmed SYNPO protein changes within the postsynaptic density in schizophrenia
24561195 Shear stress induced actin binding proteins including SYNPO may play a critical role in endothelial wound healing.
22217474 These results suggested that the SA is an important component of the molecular machinery controlling the calcium-dependent accumulation of AMPA-receptors (AMPA-R) at excitatory synapses. [review]
21655212 The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy.
20630939 Podocyte BK(Ca) channels are regulated by synaptopodin, Rho, and actin microfilaments.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19666657 Heterozygous mutations in the promoters of the ACTN4 and SYNPO genes are found in patients with idiopathic focal segmental glomerulosclerosis.
More...

AA Sequence

MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSAC      1 - 70
RVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKPALGRSTS     71 - 140
LTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPG    141 - 210
HAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAAL    211 - 280
LTANGLHLSQNREAQQSSPAPPPAEVHSPAADVNQNLASPSATLTTPTSNSSHNPPATDVNQNPPATVVP    281 - 350
QSLPLSSIQQNSSEAQLPSNGTGPASKPSTLCADGQPQAPAEEVRCSTLLIDKVSTPATTTSTFSREATL    351 - 420
IPSSRPPASDFMSSSLLIDIQPNTLVVSADQEMSGRAAATTPTKVYSEVHFTLAKPPSVVNRTARPFGIQ    421 - 490
APGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVERRMMGQRSPASERRPLGNFT    491 - 560
APPTYTETLSTAPLASWVRSPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEK    561 - 630
PKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCL    631 - 700
KSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPSPTMSLPSSWKYPTNAP    701 - 770
GAFRVASRSPARTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL    771 - 840
DLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSPRAKQAPRPSF    841 - 910
STRNAGIEAQVWKPSFCFK                                                       911 - 929
//

Text Mined References (40)

PMID Year Title
25295576 2015 A heterozygous female with Fabry disease due to a novel ?-galactosidase A mutation exhibits a unique synaptopodin distribution in vacuolated podocytes.
25145932 2015 A novel missense mutation of Wilms' Tumor 1 causes autosomal dominant FSGS.
25048004 2015 Proteomic and genomic evidence implicates the postsynaptic density in schizophrenia.
24561195 2014 Expression of synaptopodin in endothelial cells exposed to laminar shear stress and its role in endothelial wound healing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22217474 2012 Synaptopodin and the spine apparatus organelle-regulators of different forms of synaptic plasticity?
21655212 2011 Urinary podocyte-associated mRNA profile in various stages of diabetic nephropathy.
20630939 2010 Regulation of podocyte BK(Ca) channels by synaptopodin, Rho, and actin microfilaments.
More...