Property Summary

NCBI Gene PubMed Count 62
PubMed Score 130.43
PubTator Score 87.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Bladder Neoplasm 112
Myeloid Leukemia 19
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.0332133175040823
Disease Target Count Z-score Confidence
Laryngotracheitis 10 5.395 2.7
Cancer 2499 3.168 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
Alzheimer's disease 1.100 3.3e-02
Breast cancer 2.300 2.7e-02
acute quadriplegic myopathy 1.014 5.2e-05
adult high grade glioma 1.900 2.1e-03
astrocytic glioma 1.100 6.5e-03
Astrocytoma, Pilocytic 1.100 2.9e-03
atypical teratoid / rhabdoid tumor 2.000 4.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.101 8.3e-03
dermatomyositis 1.300 7.3e-04
diabetes mellitus -1.300 1.1e-03
Down syndrome 1.100 4.7e-03
ependymoma 1.400 2.9e-02
glioblastoma 1.200 9.4e-03
group 4 medulloblastoma 1.100 2.6e-02
juvenile dermatomyositis 1.065 2.9e-09
malignant mesothelioma 1.200 1.7e-05
medulloblastoma, large-cell 2.100 2.0e-05
Multiple myeloma 1.410 1.4e-02
oligodendroglioma 1.400 4.9e-02
osteosarcoma 2.683 3.9e-07
ovarian cancer -1.200 1.1e-05
pancreatic ductal adenocarcinoma liver m... 1.223 3.7e-02
Pick disease 1.800 4.7e-06
primitive neuroectodermal tumor 1.600 5.5e-04
psoriasis -1.200 3.5e-04
Rheumatoid arthritis 1.700 4.7e-03
Waldenstrons macroglobulinemia 1.588 1.1e-02

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGGGKPPSGPNRM      1 - 70
NGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQ     71 - 140
NSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDS    141 - 210
QVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDE    211 - 280
IENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTA    281 - 350
LQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA    351 - 420
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATE    421 - 490
LLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDR    491 - 560
TKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLE    561 - 630
ACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNA    631 - 700
HDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQ    701 - 770
ICQHYLTNVNTTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD    771 - 840
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQI    841 - 910
DKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEF    911 - 980
AFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLPLMSYRNSLLA    981 - 1050
GGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQ   1051 - 1120
LTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMD   1121 - 1190
FDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF                                1191 - 1231
//

Text Mined References (71)

PMID Year Title