Property Summary

NCBI Gene PubMed Count 51
Grant Count 528
R01 Count 340
Funding $58,520,547.1
PubMed Score 116.29
PubTator Score 87.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Synonym

Accession Q8N3U4 B1AMT5 D3DTF5 O00540 Q5JTI6 Q68DE9 Q9H1N8
Symbols SA2
SA-2
SCC3B
bA517O1.1

Gene

PDB

4PJU   4PJW   4PK7  

Gene RIF (28)

PMID Text
25979289 Characterization of C-terminal nuclear localization signal of the human SA2 stromalin
25867412 Data show a significantly higher stromal antigen 2 (STAG2) mRNA and protein levels in normal bladder cells than bladder cancer cells.
25677961 We suggest that increased STAG2 gene copy number and dysregulation of its downstream target genes may be responsible for the specific clinical findings of this syndrome.
25450604 Microduplication of chromosome Xq25 encompassing STAG2 gene in a boy with intellectual disability
25223734 Genomic landscape of Ewing sarcoma defines an aggressive subtype with co-association of STAG2 and TP53 mutations
25186949 Loss of STAG2 expression occurs in 15% of tumors and is associated with metastatic disease, suggesting a potential genetic vulnerability in Ewing sarcoma
25074805 STAG2 promotes the correction of kMT attachment errors to ensure faithful chromosome segregation during mitosis.
25010205 In an independent EFT tissue microarray cohort, we show that STAG2 loss as detected by immunohistochemistry may be associated with more advanced disease (p = 0.15) and a modest decrease in overall survival (p = 0.10).
25006131 Cross-sectional deep-sequencing analysis for clonal hierarchy demonstrated STAG2, SMC3, and RAD21 mutations to be ancestral in 18%, 18%, and 47% of cases, respectively, and each expanded to clonal dominance concordant with disease transformation
24822266 Aneuploidy in human salivary gland carcinomas is not driven by loss of expression of STAG2.
More...

AA Sequence

MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGGGKPPSGPNRM      1 - 70
NGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQ     71 - 140
NSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDS    141 - 210
QVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDE    211 - 280
IENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTA    281 - 350
LQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA    351 - 420
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATE    421 - 490
LLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDR    491 - 560
TKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLE    561 - 630
ACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNA    631 - 700
HDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQ    701 - 770
ICQHYLTNVNTTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD    771 - 840
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQI    841 - 910
DKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEF    911 - 980
AFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLPLMSYRNSLLA    981 - 1050
GGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQ   1051 - 1120
LTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMD   1121 - 1190
FDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF                                1191 - 1231
//

Text Mined References (60)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25979289 2015 A compound C-terminal nuclear localization signal of human SA2 stromalin.
25867412 2015 Loss of STAG2 causes aneuploidy in normal human bladder cells.
25677961 2016 Xq25 duplication: the crucial role of the STAG2 gene in this novel human cohesinopathy.
25450604 2015 Microduplication of chromosome Xq25 encompassing STAG2 gene in a boy with intellectual disability.
25223734 2014 Genomic landscape of Ewing sarcoma defines an aggressive subtype with co-association of STAG2 and TP53 mutations.
25186949 2014 The genomic landscape of pediatric Ewing sarcoma.
25074805 2014 STAG2 promotes error correction in mitosis by regulating kinetochore-microtubule attachments.
25010205 2014 The genomic landscape of the Ewing Sarcoma family of tumors reveals recurrent STAG2 mutation.
25006131 2014 Genetic alterations of the cohesin complex genes in myeloid malignancies.
More...