Knowledge Summary

Patent

No data available

Synonym

Accession Q8N3U1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPDASLGSLGITWCFLESPLEVSSGRFGLARLLGSQDHGDDPAERGRTATDAWGPSRWGQSPGNGGGYCD      1 - 70
ASPPSALAPGDRAWALPASPSSGAPASQHCCLEKAGTRTKASPVWGRDGNTWN                      71 - 123
//

Text Mined References (1)

PMID Year Title