Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 3.8e-03
Astrocytoma, Pilocytic 1.800 9.0e-07
Atopic dermatitis -1.100 5.9e-04
breast carcinoma -1.400 5.7e-04
ductal carcinoma in situ -3.100 4.2e-05
fibroadenoma -1.800 4.4e-03
glioblastoma -1.700 1.9e-03
group 4 medulloblastoma -1.500 1.3e-04
interstitial cystitis -1.300 6.4e-04
intraductal papillary-mucinous adenoma (... -1.200 1.9e-03
intraductal papillary-mucinous carcinoma... -1.100 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.400 7.1e-03
invasive ductal carcinoma -3.400 2.3e-04
osteosarcoma -4.809 1.7e-06
psoriasis -2.000 2.3e-88
subependymal giant cell astrocytoma -1.252 2.8e-02

Gene RIF (2)

AA Sequence

MRSEGAAPGPAAPLCGALSLLLGALLGKVIEGHGVTDNIQRFSSLPPYLPVSYHILRAETSFFLKEANQD      1 - 70
LLRNSSLQARVESFFTYKTRQPPVLNASYGPFSVEKVVPLDLMLTSNFLGPTNKFSFDWKLKAHILRDKV     71 - 140
YLSRPKVQVLFHIMGRDWDDHGAGEKLPCLRVFAFRETREVRGSCRLKGDLGLCVAELELLSSWFSAPTV    141 - 210
GAGRKKSMDQPEGTPVELYYTVHPGNERGDCAGGDFRKGNAIRPGKDGLEETTSHLQRIGTVGLYRAQDS    211 - 280
AQLSELRLDGNVVIWLPSRPVKQGEVVTAYVTISSNSSVDLFILRAKVKKGVNILSAQTREPRQWGVKQE    281 - 350
VGSGGKHVTATVACQRLGPSPRNRSSSLFNEVVQMNFEIASFSSLSGTQPITWQVEYPRKGTTDIAVSEI    351 - 420
FVSQKDLVGIVPLAMDTEILNTAVLTGKTVAMPIKVVSVEENSAVMDISESVECKSTDEDVIKVSERCDY    421 - 490
IFVNGKEIKGKMDAVVNFTYQYLSAPLCVTVWVPRLPLQIEVSDTELSQIKGWRVPIVTNKRPTRESEDE    491 - 560
DEEERRGRGCALQYQHATVRVLTQFVSEGAGPWGQPNYLLSPNWQFDITHLVADFMKLEEPHVATLQDSR    561 - 630
VLVGREVGMTTIQVLSPLSDSILAEKTITVLDDKVSVTDLAIQLVAGLSVALYPNAENSKAVTAVVTAEE    631 - 700
VLRTPKQEAVFSTWLQFSDGSVTPLDIYDTKDFSLAATSQDEAVVSVPQPRSPRWPVVVAEGEGQGPLIR    701 - 770
VDMTIAEACQKSKRKSILAVGVGNVRVKFGQNDADSSPGGDYEEDEIKNHASDRRQKGQHHERTGQDGHL    771 - 840
YGSSPVEREEGALRRATTTARSLLDNKVVKNSRADGGRLAGEGQLQNIPIDFTNFPAHVDLPKAGSGLEE    841 - 910
NDLVQTPRGLSDLEIGMYALLGVFCLAILVFLINCATFALKYRHKQVPLEGQASMTHSHDWVWLGNEAEL    911 - 980
LESMGDAPPPQDEHTTIIDRGPGACEESNHLLLNGGSHKHVQSQIHRSADSGGRQGREQKQDPLHSPTSK    981 - 1050
RKKVKFTTFTTIPPDDSCPTVNSIVSSNDEDIKWVCQDVAVGAPKELRNYLEKLKDKA               1051 - 1108
//

Text Mined References (6)

PMID Year Title