Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.01
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pituitary cancer 1972 4.17518572635493E-6
psoriasis 6685 5.33342826595307E-6
ovarian cancer 8492 1.00998704858248E-5
acute quadriplegic myopathy 1157 1.61035800426148E-5
posterior fossa group A ependymoma 1511 9.29658065424221E-5
osteosarcoma 7933 1.03962091524617E-4
atypical teratoid/rhabdoid tumor 1095 2.57396447709285E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.16209016533781E-4
ductal carcinoma in situ 1745 4.14690420063742E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.03833943419977E-4
invasive ductal carcinoma 2950 8.85694480391475E-4
breast carcinoma 1614 0.00132767117735884
pilocytic astrocytoma 3086 0.00188170003040065
sonic hedgehog group medulloblastoma 1482 0.0021374178029178
cystic fibrosis 1670 0.00276167758402415
Pick disease 1893 0.00394084518233534
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00445947979721228
Atopic dermatitis 944 0.00885452745163562
Breast cancer 3099 0.0250450794678322
oligodendroglioma 2849 0.0348233943808661
fibroadenoma 557 0.0475436209106971

Expression

Synonym

Accession Q8N3T1 A6NMN1 B2R638 F1LIP6 Q86T60 Q96C46 Q96DJ5
Symbols PIH5
GALNT7
GALNT13
GALNTL2
GALNACT15
pp-GalNAc-T15

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 GO Process (1)

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE      1 - 70
AEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADED     71 - 140
GEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRT    141 - 210
VHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLV    211 - 280
FMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK    281 - 350
ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQ    351 - 420
NQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLA    421 - 490
NVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQH    491 - 560
LCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRF    561 - 630
DQINAVDER                                                                 631 - 639
//

Text Mined References (16)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147861 2004 Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...