Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.75
PubTator Score 5.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Breast cancer -2.700 2.5e-02
acute quadriplegic myopathy 1.297 1.6e-05
Astrocytoma, Pilocytic 1.200 2.8e-02
Atopic dermatitis -1.300 8.9e-03
atypical teratoid / rhabdoid tumor -1.600 2.0e-03
breast carcinoma -1.400 1.3e-03
cystic fibrosis 1.169 9.9e-05
ductal carcinoma in situ -3.100 4.1e-04
ependymoma 1.200 4.5e-02
fibroadenoma -1.300 4.8e-02
group 4 medulloblastoma -1.600 5.1e-03
intraductal papillary-mucinous adenoma (... -1.200 3.2e-04
intraductal papillary-mucinous carcinoma... -1.200 5.0e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.5e-03
invasive ductal carcinoma -3.600 8.9e-04
oligodendroglioma 1.200 3.5e-02
osteosarcoma -2.860 1.0e-04
ovarian cancer -1.200 2.1e-06
Pick disease 1.400 3.9e-03
pituitary cancer -1.500 2.9e-05
psoriasis -1.100 6.4e-08

Gene RIF (1)

AA Sequence

MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE      1 - 70
AEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADED     71 - 140
GEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRT    141 - 210
VHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLV    211 - 280
FMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK    281 - 350
ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQ    351 - 420
NQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLA    421 - 490
NVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQH    491 - 560
LCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRF    561 - 630
DQINAVDER                                                                 631 - 639
//

Text Mined References (16)

PMID Year Title