Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.44
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy -1.395 1.5e-05
adrenocortical carcinoma 1.377 8.3e-06
atypical teratoid / rhabdoid tumor 1.800 1.3e-05
autosomal dominant Emery-Dreifuss muscul... -1.275 1.9e-02
Breast cancer -2.300 2.8e-02
cystic fibrosis -1.023 3.9e-03
dermatomyositis -1.200 1.0e-03
Duchenne muscular dystrophy -1.497 1.2e-04
gastric carcinoma 1.300 6.3e-03
glioblastoma 1.700 2.3e-03
group 4 medulloblastoma 2.100 4.5e-04
hereditary spastic paraplegia -1.075 9.4e-03
limb girdle muscular dystrophy 2A -1.042 1.1e-02
malignant mesothelioma 1.800 3.5e-07
medulloblastoma, large-cell 2.300 3.8e-07
Multiple myeloma 1.106 1.4e-02
non-small cell lung cancer 1.020 3.8e-17
osteosarcoma 2.451 9.5e-05
primary Sjogren syndrome 1.300 1.1e-03
Rheumatoid arthritis 1.300 1.7e-02
spina bifida -1.019 3.2e-02
tuberculosis and treatment for 3 months 1.400 2.0e-05
Waldenstrons macroglobulinemia 1.274 1.1e-02

Protein-protein Interaction (6)

AA Sequence

MASKVTDAIVWYQKKEFLSVATTAPGPQQVLPGYCQCSLKDQGLFIQCLIGAYDQQIWEKSVEQREIKFI      1 - 70
KLGLRNKPKKTAHVKPDLIDVDLVRGSAFAKAKPESPWTSLTRKGIVRVVFFPFFFRWWLQVTSKVIFFW     71 - 140
LLVLYLLQVAAIVLFCSTSSPHSIPLTEVIGPIWLMLLLGTVHCQIVSTRTPKPPLSTGGKRRRKLRKAA    141 - 210
HLEVHREGDGSSTTDNTQEGAVQNHGTSTSHSVGTVFRDLWHAAFFLSGSKKAKNSIDKSTETDNGYVSL    211 - 280
DGKKTVKSGEDGIQNHEPQCETIRPEETAWNTGTLRNGPSKDTQRTITNVSDEVSSEEGPETGYSLRRHV    281 - 350
DRTSEGVLRNRKSHHYKKHYPNEDAPKSGTSCSSRCSSSRQDSESARPESETEDVLWEDLLHCAECHSSC    351 - 420
TSETDVENHQINPCVKKEYRDDPFHQSHLPWLHSSHPGLEKISAIVWEGNDCKKADMSVLEISGMIMNRV    421 - 490
NSHIPGIGYQIFGNAVSLILGLTPFVFRLSQATDLEQLTAHSASELYVIAFGSNEDVIVLSMVIISFVVR    491 - 560
VSLVWIFFFLLCVAERTYKQRLLFAKLFGHLTSARRARKSEVPHFRLKKVQNIKMWLSLRSYLKRRGPQR    561 - 630
SVDVIVSSAFLLTISVVFICCAQLLHVHEIFLDCHYNWELVIWCISLTLFLLRFVTLGSETSKKYSNTSI    631 - 700
LLTEQINLYLKMEKKPNKKEELTLVNNVLKLATKLLKELDSPFRLYGLTMNPLLYNITQVVILSAVSGVI    701 - 770
SDLLGFNLKLWKIKS                                                           771 - 785
//

Text Mined References (17)

PMID Year Title