Property Summary

NCBI Gene PubMed Count 42
PubMed Score 137.22
PubTator Score 53.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.2e-04
ependymoma 1.100 2.2e-09
group 3 medulloblastoma -1.200 3.8e-03
interstitial cystitis -1.100 1.3e-05
medulloblastoma, large-cell -2.400 4.5e-05
ovarian cancer -1.900 5.1e-09
ulcerative colitis -1.200 2.6e-05

Gene RIF (13)

AA Sequence

MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRR      1 - 70
EEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVD     71 - 140
SQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTA    141 - 210
LLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVII    211 - 280
SRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHV    281 - 350
KAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK    351 - 420
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNC    421 - 490
GQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSI    491 - 560
DSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTRE    561 - 630
MEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR                             631 - 675
//

Text Mined References (47)

PMID Year Title