Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.23
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.100 4.9e-04
intraductal papillary-mucinous neoplasm ... 1.300 5.5e-03
medulloblastoma, large-cell -1.100 9.5e-04
osteosarcoma -2.588 3.0e-06
ovarian cancer -2.100 2.7e-09
pancreatic cancer 1.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.576 1.6e-03

Synonym

Accession Q8N3R3 A8K9P1 Q0P5T9 Q495R1 Q495R3 Q4G0M4 Q6GMU8
Symbols TOAG1
TOAG-1
C3orf23

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVEREINENSLKRLSVYLE      1 - 70
NLQKPGFKSLKPTQLTFYVRETDQSSSDGQEPFSTSGFRAVKFTLHTRDLLSTVLYILNSCSLSVEHIQS     71 - 140
LNTNMHTQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLP    141 - 210
LRKELDRLKDELSHQLQLSDIRWQRSWGIAHRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVG    211 - 280
HVMLGTMDVHHHWTKLFERLPSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYN    281 - 350
RLLKSRILFHPRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKV    351 - 420
IENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWK    421 - 490
NGEAIK                                                                    491 - 496
//

Text Mined References (16)

PMID Year Title