Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.39
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.69101340873403E-9
osteosarcoma 7933 3.01213421488038E-6
pancreatic cancer 2300 1.22419136297124E-4
group 4 medulloblastoma 1875 4.90046696768313E-4
medulloblastoma, large-cell 6234 9.45235235937897E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00163204905400457
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00243898129514414

Expression

  Differential Expression (7)

Synonym

Accession Q8N3R3 A8K9P1 Q0P5T9 Q495R1 Q495R3 Q4G0M4 Q6GMU8
Symbols TOAG1
TOAG-1
C3orf23

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVEREINENSLKRLSVYLE      1 - 70
NLQKPGFKSLKPTQLTFYVRETDQSSSDGQEPFSTSGFRAVKFTLHTRDLLSTVLYILNSCSLSVEHIQS     71 - 140
LNTNMHTQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLP    141 - 210
LRKELDRLKDELSHQLQLSDIRWQRSWGIAHRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVG    211 - 280
HVMLGTMDVHHHWTKLFERLPSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYN    281 - 350
RLLKSRILFHPRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKV    351 - 420
IENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWK    421 - 490
NGEAIK                                                                    491 - 496
//

Text Mined References (16)

PMID Year Title
23799424 2013 Expansion of memory-type CD8+ T cells correlates with the failure of early immunosuppression withdrawal after cadaver liver transplantation using high-dose ATG induction and rapamycin.
23222918 2013 B-cell-related biomarkers of tolerance are up-regulated in rejection-free kidney transplant recipients.
21804023 2011 Cutting Edge: Immunological consequences and trafficking of human regulatory macrophages administered to renal transplant recipients.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19684086 2009 Expression of tolerance associated gene-1, a mitochondrial protein inhibiting T cell activation, can be used to predict response to immune modulating therapies.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...