Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.86
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif downregulates the expression of taxilin beta (TXLNB) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15184072 identification of isoforms of taxilin; interaction with syntaxin; tissue distribution [beta-taxilin, gamma-taxilin].

AA Sequence

MEANHSEQLSAERQSTPPGDSSSLPSHNGLEKEDGQDSPTPVQPPEKEASVHPDISEELNRQLEDIINTY      1 - 70
GSAASTAGKEGSARASEQPENAESPDNEDGDCEETTEEAGREPVASGEPPTVKEPVSNKEQKLEKKILKG     71 - 140
LGKEANLLMQNLNKLQTPEEKFDFLFKKYAELLDEHRTEQKKLKLLQKKQVQIQKEKDQLQGEHSRAILA    141 - 210
RSKLESLCRELQRHNKTLKEEALQRAREEEEKRKEITSHFQSTLTDIQGQIEQQSERNMKLCQENTELAE    211 - 280
KLKSIIDQYELREEHLDKIFKHRELQQKLVDAKLEQAQEMMKEAEERHKREKEYLLNQAAEWKLQAKVLK    281 - 350
EQETVLQAQLTLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALLDMI    351 - 420
EEKALRAKEYECFVMKIGRLENLCRALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDA    421 - 490
EEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEIGSSQESADAALKEPEQPPLIPSRDSESPLPPLT    491 - 560
PQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADV    561 - 630
PAPACAAEEHVAAMVPACEPSRQPPRAAAEELPVGASAGPQPRNVADTNLEGVD                    631 - 684
//

Text Mined References (15)

PMID Year Title
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184072 2004 Identification and characterization of taxilin isoforms.
15082161 2004 Muscle-specific protein MDP77 specifically promotes motor nerve regeneration in rats.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...