Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.86
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
adult high grade glioma 2148 0.00335735686135502
chronic rhinosinusitis 512 0.0138512635683051
cystic fibrosis and chronic rhinosinusitis 213 0.0428883910955731
Disease Target Count Z-score Confidence
Myotonic dystrophy type 1 16 4.105 2.1

Expression

  Differential Expression (3)

Synonym

Accession Q8N3L3 Q5VTF3 Q76L25 Q86T52 Q8N3S2
Symbols MDP77
LST001
C6orf198
dJ522B19.2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif downregulates the expression of taxilin beta (TXLNB) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15184072 identification of isoforms of taxilin; interaction with syntaxin; tissue distribution [beta-taxilin, gamma-taxilin].

AA Sequence

MEANHSEQLSAERQSTPPGDSSSLPSHNGLEKEDGQDSPTPVQPPEKEASVHPDISEELNRQLEDIINTY      1 - 70
GSAASTAGKEGSARASEQPENAESPDNEDGDCEETTEEAGREPVASGEPPTVKEPVSNKEQKLEKKILKG     71 - 140
LGKEANLLMQNLNKLQTPEEKFDFLFKKYAELLDEHRTEQKKLKLLQKKQVQIQKEKDQLQGEHSRAILA    141 - 210
RSKLESLCRELQRHNKTLKEEALQRAREEEEKRKEITSHFQSTLTDIQGQIEQQSERNMKLCQENTELAE    211 - 280
KLKSIIDQYELREEHLDKIFKHRELQQKLVDAKLEQAQEMMKEAEERHKREKEYLLNQAAEWKLQAKVLK    281 - 350
EQETVLQAQLTLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALLDMI    351 - 420
EEKALRAKEYECFVMKIGRLENLCRALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDA    421 - 490
EEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEIGSSQESADAALKEPEQPPLIPSRDSESPLPPLT    491 - 560
PQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADV    561 - 630
PAPACAAEEHVAAMVPACEPSRQPPRAAAEELPVGASAGPQPRNVADTNLEGVD                    631 - 684
//

Text Mined References (15)

PMID Year Title
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184072 2004 Identification and characterization of taxilin isoforms.
15082161 2004 Muscle-specific protein MDP77 specifically promotes motor nerve regeneration in rats.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...