Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.76
PubTator Score 2.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (1)

PMID Text
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFST      1 - 70
TTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMHQRVHTGE     71 - 140
KPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQ    141 - 210
SSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI                       211 - 261
//

Text Mined References (19)

PMID Year Title
24667120 2014 Genome-wide association study identifies new disease loci for isolated clubfoot.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21695231 2011 Exome sequencing identifies ZNF644 mutations in high myopia.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...