Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.93
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.9
Disease Target Count Z-score Confidence
Clubfoot 39 3.536 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.200 4.3e-04
intraductal papillary-mucinous carcinoma... 1.100 2.5e-03
osteosarcoma 2.336 3.3e-06
ovarian cancer 1.300 5.3e-03
posterior fossa group B ependymoma 1.100 1.1e-09

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFST      1 - 70
TTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMHQRVHTGE     71 - 140
KPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQ    141 - 210
SSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI                       211 - 261
//

Text Mined References (20)

PMID Year Title