Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.71
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -4.200 0.000
posterior fossa group A ependymoma -5.400 0.000
group 4 medulloblastoma -4.500 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -5.600 0.000
primitive neuroectodermal tumor -3.400 0.007
interstitial cystitis -1.500 0.005
pediatric high grade glioma -3.300 0.000
subependymal giant cell astrocytoma -2.829 0.020
lung carcinoma 2.500 0.000
Pick disease -1.200 0.000
pituitary cancer 2.200 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8N3J6 G3XHN7 G3XHN8 Q3KQY9 Q658Q7 Q8IZP8
Symbols NECL3
IGSF4D
Necl-3
synCAM2
SynCAM 2

Gene

PANTHER Protein Class (1)

Gene RIF (8)

PMID Text
25869804 A significant association was observed for the single-nucleotide polymorphism (SNP) rs17518584 and in the joint discovery and replication meta-analysis in an intron of the gene cell adhesion molecule 2 (CADM2) for performance on the LDST/DSST.
25335893 In the absence of SynCAMs, selective axon-axon interactions are perturbed resulting in aberrant pathfinding of sensory axons.
24240726 Cox regression analysis indicated that CADM2 expression level, tumor size, tumor number, vascular invasion, HBsAg were independent risk factors for HCC recurrence
23643812 Thus, we conclude that CADM2 functions as a novel tumor suppressor and may serve as a potential therapeutic target for human renal cell carcinoma.
21864505 The results indicated that CADM2 is one of the pathogenic factors for psoriasis.
21062931 Its expression is regulated in part by promoter methylation and implicates CADM-2 as a previously unrecognized tumor suppressor gene in a proportion of human prostate cancers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKK      1 - 70
ALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGD     71 - 140
LMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESL    141 - 210
NATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRE    211 - 280
LNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATT    281 - 350
SSIRDPNALAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA    351 - 420
EGSQVNAEEKKEYFI                                                           421 - 435
//

Text Mined References (20)

PMID Year Title
25869804 2016 GWAS for executive function and processing speed suggests involvement of the CADM2 gene.
25335893 2014 The SynCAM synaptic cell adhesion molecules are involved in sensory axon pathfinding by regulating axon-axon contacts.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
24240726 2014 Low CADM2 expression predicts high recurrence risk of hepatocellular carcinoma patients after hepatectomy.
23643812 2013 Aberrant methylation and loss of CADM2 tumor suppressor expression is associated with human renal cell carcinoma tumor progression.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21864505 2011 A novel splicing variant of CADM2 as a protective transcript of psoriasis.
21062931 2010 Hypoexpression and epigenetic regulation of candidate tumor suppressor gene CADM-2 in human prostate cancer.
More...