Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.45
PubTator Score 10.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.116 1.4e-02
adult high grade glioma -1.400 1.8e-06
atypical teratoid / rhabdoid tumor -2.800 3.9e-08
Breast cancer -1.500 2.0e-04
ependymoma -1.500 2.8e-02
glioblastoma -1.500 1.3e-07
group 3 medulloblastoma -2.000 1.0e-06
intraductal papillary-mucinous carcinoma... -1.600 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 4.5e-03
juvenile dermatomyositis 1.342 4.4e-12
lung adenocarcinoma -1.500 3.1e-10
medulloblastoma, large-cell -3.100 5.6e-07
oligodendroglioma -1.100 4.2e-02
osteosarcoma -1.397 7.8e-04
ovarian cancer -3.700 1.2e-18
pituitary cancer -1.800 3.5e-05
primitive neuroectodermal tumor -1.300 2.8e-02
ulcerative colitis 1.500 2.6e-04

Protein-protein Interaction (3)

Gene RIF (9)

AA Sequence

MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR      1 - 70
IDEPILLPPSIKYGKPIPKISLENVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT     71 - 140
HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR    141 - 210
AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET    211 - 280
KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG    281 - 350
KYKNSEINFSFSRSFASSGRWA                                                    351 - 372
//

Text Mined References (26)

PMID Year Title