Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.48
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 6.1e-03
malignant mesothelioma 1.200 1.1e-06
osteosarcoma -1.115 8.6e-03
ovarian cancer 1.500 1.0e-04
sonic hedgehog group medulloblastoma 1.200 1.1e-05

Synonym

Accession Q8N3J2 B2RNA1 Q2TAA7 Q9H5U9
Symbols HsT661

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTK      1 - 70
PENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVF     71 - 140
NQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPS    141 - 210
LNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKT    211 - 280
FDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEV    281 - 350
VAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHK    351 - 420
PPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIAVESGS                      421 - 472
//

Text Mined References (11)

PMID Year Title