Property Summary

NCBI Gene PubMed Count 33
PubMed Score 8.11
PubTator Score 12.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 5 2 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 7.2e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Obesity 678 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.100 7.2e-07

Protein-protein Interaction (6)

Gene RIF (6)

AA Sequence

MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVS      1 - 70
VGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDF     71 - 140
KLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIK    141 - 210
IRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALT    211 - 280
VEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS             281 - 341
//

Text Mined References (34)

PMID Year Title