Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.68
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.700 0.001
posterior fossa group A ependymoma -3.200 0.000
oligodendroglioma -2.300 0.000
glioblastoma -3.900 0.000
osteosarcoma -2.204 0.000
medulloblastoma -2.900 0.001
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.600 0.002
primitive neuroectodermal tumor -2.800 0.002
interstitial cystitis -2.800 0.000
adult high grade glioma -3.400 0.000
pilocytic astrocytoma -2.000 0.001
pituitary cancer -2.300 0.000

Gene RIF (3)

PMID Text
25112515 Variants of FAM19A2 (rs348644) are associated with forced expiratory volume in COPD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCF      1 - 70
PGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH              71 - 131
//

Text Mined References (14)

PMID Year Title
25112515 2014 Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...