Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.76237276162831E-7
Breast cancer 3099 2.25351648760894E-5
pilocytic astrocytoma 3086 6.76501958322309E-4
glioblastoma 5572 0.00206169098357581
medulloblastoma, large-cell 6234 0.00257147793164719
Pick disease 1893 0.00682731483397709
atypical teratoid / rhabdoid tumor 4369 0.00689752781501181
adult high grade glioma 2148 0.0112724811682978
group 4 medulloblastoma 1875 0.0186927335516593
subependymal giant cell astrocytoma 2287 0.033958368636014
astrocytic glioma 2241 0.0364921494583948

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.036
glioblastoma -1.600 0.002
posterior fossa group B ependymoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.007
medulloblastoma, large-cell -1.300 0.003
adult high grade glioma -1.400 0.011
group 4 medulloblastoma 1.300 0.019
pilocytic astrocytoma -1.400 0.001
subependymal giant cell astrocytoma -1.779 0.034
Pick disease -1.100 0.007
Breast cancer 1.100 0.000

Synonym

Accession Q8N3F9 Q86SM2
Symbols TM7SF1L2

Gene

  Ortholog (12)

AA Sequence

MRVSVPGPAAAAAPAAGREPSTPGGGSGGGGAVAAASGAAVPGSVQLALSVLHALLYAALFAFAYLQLWR      1 - 70
LLLYRERRLSYQSLCLFLCLLWAALRTTLFSAAFSLSGSLPLLRPPAHLHFFPHWLLYCFPSCLQFSTLC     71 - 140
LLNLYLAEVICKVRCATELDRHKILLHLGFIMASLLFLVVNLTCAMLVHGDVPENQLKWTVFVRALINDS    141 - 210
LFILCAISLVCYICKITKMSSANVYLESKGMSLCQTVVVGSVVILLYSSRACYNLVVVTISQDTLESPFN    211 - 280
YGWDNLSDKAHVEDISGEEYIVFGMVLFLWEHVPAWSVVLFFRAQRLNQNLAPAGMINSHSYSSRAYFFD    281 - 350
NPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAPLLFTCSNLDLNNH    351 - 420
HSLYVTPQN                                                                 421 - 429
//

Text Mined References (5)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12508121 2003 The DNA sequence and analysis of human chromosome 14.