Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 1.1e-02
astrocytic glioma -1.100 3.6e-02
Astrocytoma, Pilocytic -1.300 1.3e-03
atypical teratoid / rhabdoid tumor -1.400 6.9e-03
Breast cancer 1.100 2.3e-05
ependymoma -1.800 3.6e-06
glioblastoma -1.600 2.1e-03
group 4 medulloblastoma 1.300 1.9e-02
medulloblastoma, large-cell -1.300 2.6e-03
Pick disease -1.100 6.8e-03
subependymal giant cell astrocytoma -1.779 3.4e-02

Synonym

Accession Q8N3F9 Q86SM2
Symbols TM7SF1L2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRVSVPGPAAAAAPAAGREPSTPGGGSGGGGAVAAASGAAVPGSVQLALSVLHALLYAALFAFAYLQLWR      1 - 70
LLLYRERRLSYQSLCLFLCLLWAALRTTLFSAAFSLSGSLPLLRPPAHLHFFPHWLLYCFPSCLQFSTLC     71 - 140
LLNLYLAEVICKVRCATELDRHKILLHLGFIMASLLFLVVNLTCAMLVHGDVPENQLKWTVFVRALINDS    141 - 210
LFILCAISLVCYICKITKMSSANVYLESKGMSLCQTVVVGSVVILLYSSRACYNLVVVTISQDTLESPFN    211 - 280
YGWDNLSDKAHVEDISGEEYIVFGMVLFLWEHVPAWSVVLFFRAQRLNQNLAPAGMINSHSYSSRAYFFD    281 - 350
NPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAPLLFTCSNLDLNNH    351 - 420
HSLYVTPQN                                                                 421 - 429
//

Text Mined References (5)

PMID Year Title