Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
R01 Count 4
Funding $159,233.27
PubMed Score 6.74
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.017
esophageal adenocarcinoma -1.100 0.028
psoriasis 1.500 0.000
posterior fossa group A ependymoma 1.200 0.000
glioblastoma 1.300 0.005
primitive neuroectodermal tumor 1.500 0.000
non-small cell lung cancer 1.213 0.000
lung cancer 1.300 0.004
pediatric high grade glioma 1.200 0.001
group 3 medulloblastoma 1.300 0.007
gastric carcinoma -1.500 0.014
ovarian cancer 1.900 0.000

Gene RIF (7)

PMID Text
25287187 suggesting an EHD1-independent function for MICAL-L1 earlier in mitosis
25248744 DGKalpha generates phosphatidic acid to drive its own recruitment to tubular recycling endosomes via its interaction with MICAL-L1
24481818 MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
23596323 Cooperation of MICAL-L1, pacsin 2 (syndapin2), and phosphatidic acid in tubular recycling endosome biogenesis.
21951725 Rab35 is a critical upstream regulator of MICAL-L1 and Arf6, while both MICAL-L1 and Arf6 regulate Rab8a function.
21795389 novel insights into the MICAL-L1/Rab protein complex that can regulate EGFR trafficking at late endocytic pathways.
19864458 These data implicate MICAL-L1 as an unusual type of Rab effector that regulates endocytic recycling by recruiting and linking EHD1 and Rab8a on membrane tubules.

AA Sequence

MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVA      1 - 70
EKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDV     71 - 140
AQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEG    141 - 210
TFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQI    211 - 280
PTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVP    281 - 350
KPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLE    351 - 420
SKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLAL    421 - 490
HASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSL    491 - 560
ASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSC    561 - 630
KENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEH    631 - 700
RGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPE    701 - 770
KDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFK    771 - 840
TMKMLKLLGNKRDAKSKSPRDKS                                                   841 - 863
//

Text Mined References (34)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25287187 2015 Novel functions for the endocytic regulatory proteins MICAL-L1 and EHD1 in mitosis.
25248744 2014 Diacylglycerol kinase ? regulates tubular recycling endosome biogenesis and major histocompatibility complex class I recycling.
24481818 2014 Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23596323 2013 Cooperation of MICAL-L1, syndapin2, and phosphatidic acid in tubular recycling endosome biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22284051 2012 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.
21951725 2012 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a.
More...