Property Summary

NCBI Gene PubMed Count 24
PubMed Score 7.57
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.100 7.1e-05
esophageal adenocarcinoma -1.100 2.8e-02
gastric carcinoma -1.300 1.3e-02
glioblastoma 1.200 1.6e-05
group 3 medulloblastoma 1.300 7.2e-03
lung cancer 1.100 1.6e-02
non-small cell lung cancer 1.076 7.4e-10
ovarian cancer 1.900 1.0e-05
pediatric high grade glioma 1.200 8.4e-04
primitive neuroectodermal tumor 1.500 1.6e-04
psoriasis 1.100 1.3e-08
Rheumatoid arthritis 1.300 1.7e-02

Gene RIF (7)

AA Sequence

MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVA      1 - 70
EKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDV     71 - 140
AQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEG    141 - 210
TFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQI    211 - 280
PTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVP    281 - 350
KPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLE    351 - 420
SKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLAL    421 - 490
HASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSL    491 - 560
ASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSC    561 - 630
KENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEH    631 - 700
RGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPE    701 - 770
KDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFK    771 - 840
TMKMLKLLGNKRDAKSKSPRDKS                                                   841 - 863
//

Text Mined References (34)

PMID Year Title