Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 9.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 1.9e-03
atypical teratoid / rhabdoid tumor -2.300 3.6e-08
Breast cancer -3.700 2.2e-15
breast carcinoma -1.600 1.6e-33
colon cancer -2.000 2.3e-03
ductal carcinoma in situ -1.500 2.7e-04
gastric carcinoma 1.800 7.2e-03
glioblastoma 1.100 9.8e-04
invasive ductal carcinoma -2.400 2.8e-03
lung adenocarcinoma -1.300 1.2e-06
malignant mesothelioma -1.400 3.4e-07
medulloblastoma -1.200 2.0e-03
medulloblastoma, large-cell 1.500 1.5e-05
nasopharyngeal carcinoma -1.100 2.0e-03
non-small cell lung cancer -1.126 4.0e-13
ovarian cancer -3.800 2.4e-09
primitive neuroectodermal tumor -1.300 1.4e-02

AA Sequence

MTIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEILFDPKTSVSEL      1 - 70
FAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDGLTDMTLLHYTCKSGAHGIGDVETAVKFATQLIDLGA     71 - 140
DISLRSRWTNMNALHYAAYFDVPELIRVILKTSKPKDVDATCSDFNFGTALHIAAYNLCAGAVKCLLEQG    141 - 210
ANPAFRNDKGQIPADVVPDPVDMPLEMADAAATAKEIKQMLLDAVPLSCNISKAMLPNYDHVTGKAMLTS    211 - 280
LGLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYGIFAPLSKIS    281 - 350
KAKGRRKNITHTPSTKAAVPLIRSQKIDVAHVTSKVNTGLMTSKKDSASESTLSLPPGEELKTVTEKDVA    351 - 420
LLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRASAGLNSSATSTANNSRCEGELRLGER    421 - 490
VLVVGQRLGTIRFFGTTNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCSPRYGIFAPPSRVQRVTDSLDT    491 - 560
LSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKLHEGSQVL    561 - 630
LTSSNEMGTVRYVGPTDFASGIWLGLELRSAKGKNDGSVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKL    631 - 700
VDENC                                                                     701 - 705
//

Text Mined References (6)

PMID Year Title