Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 9.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
sonic hedgehog group medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.300 0.014
non-small cell lung cancer -1.126 0.000
colon cancer -2.000 0.002
adult high grade glioma -1.500 0.002
lung adenocarcinoma -1.300 0.000
nasopharyngeal carcinoma -1.100 0.002
Breast cancer -3.700 0.000
breast carcinoma -1.600 0.000
gastric carcinoma 1.800 0.007
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.400 0.003
ovarian cancer -3.800 0.000

AA Sequence

MTIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEILFDPKTSVSEL      1 - 70
FAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDGLTDMTLLHYTCKSGAHGIGDVETAVKFATQLIDLGA     71 - 140
DISLRSRWTNMNALHYAAYFDVPELIRVILKTSKPKDVDATCSDFNFGTALHIAAYNLCAGAVKCLLEQG    141 - 210
ANPAFRNDKGQIPADVVPDPVDMPLEMADAAATAKEIKQMLLDAVPLSCNISKAMLPNYDHVTGKAMLTS    211 - 280
LGLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYGIFAPLSKIS    281 - 350
KAKGRRKNITHTPSTKAAVPLIRSQKIDVAHVTSKVNTGLMTSKKDSASESTLSLPPGEELKTVTEKDVA    351 - 420
LLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRASAGLNSSATSTANNSRCEGELRLGER    421 - 490
VLVVGQRLGTIRFFGTTNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCSPRYGIFAPPSRVQRVTDSLDT    491 - 560
LSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKLHEGSQVL    561 - 630
LTSSNEMGTVRYVGPTDFASGIWLGLELRSAKGKNDGSVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKL    631 - 700
VDENC                                                                     701 - 705
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.