Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.30
PubTator Score 32.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.347 4.3e-02
atypical teratoid / rhabdoid tumor -1.200 5.6e-03
Breast cancer -2.200 4.0e-09
cutaneous lupus erythematosus 1.300 3.9e-03
cystic fibrosis -1.100 1.6e-03
group 3 medulloblastoma -1.300 4.1e-03
lung cancer -1.400 4.1e-04
non-small cell lung cancer -1.532 5.0e-17
osteosarcoma -2.659 7.6e-04
ovarian cancer -2.600 5.4e-10

Synonym

Accession Q8N3A8 Q3KRB7 Q6DHZ1 Q9H754 PARP-8
Symbols ARTD16
pART16

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

AA Sequence

MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDYPDNTYVSSSE      1 - 70
NDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQNSTVEEDSEGDNDSEEFYYGG     71 - 140
QVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDDVDIDLHIDVSFLDEEIAVAWEVIRTEPIIV    141 - 210
RLHCSLTQYLNGPVPTVDVFQISTKERFGLGHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPL    211 - 280
HLFSTLRRSPSYPPPGCGKSKSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRA    281 - 350
EQAMTAIKSHKLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL    351 - 420
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGAKCIPVRDRGF    421 - 490
LVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQVVDL    491 - 560
LVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKKNYDRVMKALDSITSIREMTQAPYLEIKKQM    561 - 630
DKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSH    631 - 700
IENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQS    701 - 770
QKKGQQSQFLQSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH    771 - 840
KEILRVIGNQTATG                                                            841 - 854
//

Text Mined References (15)

PMID Year Title