Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.30
PubTator Score 32.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.004
osteosarcoma -2.659 0.001
atypical teratoid / rhabdoid tumor -1.200 0.006
non-small cell lung cancer -1.532 0.000
lung cancer -1.400 0.000
ulcerative colitis 2.300 0.000
cystic fibrosis -1.100 0.002
group 3 medulloblastoma -1.300 0.004
Breast cancer -2.200 0.000
ovarian cancer -2.600 0.000

AA Sequence

MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDYPDNTYVSSSE      1 - 70
NDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQNSTVEEDSEGDNDSEEFYYGG     71 - 140
QVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDDVDIDLHIDVSFLDEEIAVAWEVIRTEPIIV    141 - 210
RLHCSLTQYLNGPVPTVDVFQISTKERFGLGHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPL    211 - 280
HLFSTLRRSPSYPPPGCGKSKSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRA    281 - 350
EQAMTAIKSHKLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL    351 - 420
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGAKCIPVRDRGF    421 - 490
LVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQVVDL    491 - 560
LVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKKNYDRVMKALDSITSIREMTQAPYLEIKKQM    561 - 630
DKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSH    631 - 700
IENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQS    701 - 770
QKKGQQSQFLQSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH    771 - 840
KEILRVIGNQTATG                                                            841 - 854
//

Text Mined References (15)

PMID Year Title
23874384 2013 Genetics of callous-unemotional behavior in children.
22685421 2012 Genetic variants on chromosome 1q41 influence ocular axial length and high myopia.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...