Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.35
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N394 B2RCU7 Q8N2K8
Symbols IBDBP1

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
24764305 findings provide an important link between aneuploidy and the stress pathways activated by Aurora B inhibition and also support the use of Aurora B inhibitors in combination therapy for treatment of cancer.
23333304 HIV-1 Vif upregulates the expression of transmembrane and tetratricopeptide repeat containing 2 (TMTC2) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19386601 TMTC2 expression induced by HIF-2alpha.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MIAELVSSALGLALYLNTLSADFCYDDSRAIKTNQDLLPETPWTHIFYNDFWGTLLTHSGSHKSYRPLCT      1 - 70
LSFRLNHAIGGLNPWSYHLVNVLLHAAVTGLFTSFSKILLGDGYWTFMAGLMFASHPIHTEAVAGIVGRA     71 - 140
DVGASLFFLLSLLCYIKHCSTRGYSARTWGWFLGSGLCAGCSMLWKEQGVTVLAVSAVYDVFVFHRLKIK    141 - 210
QILPTIYKRKNLSLFLSISLLIFWGSSLLGARLYWMGNKPPSFSNSDNPAADSDSLLTRTLTFFYLPTKN    211 - 280
LWLLLCPDTLSFDWSMDAVPLLKTVCDWRNLHTVAFYTGLLLLAYYGLKSPSVDRECNGKTVTNGKQNAN    281 - 350
GHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTENIVVLSLSLLIIPFVPATNLFFYVGFVIA    351 - 420
ERVLYIPSMGFCLLITVGARALYVKVQKRFLKSLIFYATATLIVFYGLKTAIRNGDWQNEEMLYRSGIKV    421 - 490
NPAKAWGNLGNVLKSQSKISEAESAYRNALYYRSNMADMLYNLGLLLQENSRFAEALHYYKLAIGSRPTL    491 - 560
ASAYLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLGKLYHEQGHYEEALSVYK    561 - 630
EAIQKMPRQFAPQSLYNMMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLF    631 - 700
LKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDL    701 - 770
AARLRPNYPAALMNLGAILHLNGRLQKAEANYLRALQLKPDDVITQSNLRKLWNIMEKQGLKTSKT        771 - 836
//

Text Mined References (18)

PMID Year Title
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24764305 2014 TMTC1 and TMTC2 are novel endoplasmic reticulum tetratricopeptide repeat-containing adapter proteins involved in calcium homeostasis.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19386601 2009 Genome-wide association of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha DNA binding with expression profiling of hypoxia-inducible transcripts.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...