Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.65
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.224 2.0e-02
adult high grade glioma 1.400 2.1e-02
astrocytic glioma 1.200 4.2e-02
atypical teratoid / rhabdoid tumor 1.700 1.1e-02
Endometriosis -1.034 1.9e-02
glioblastoma 1.300 4.9e-03
group 4 medulloblastoma 1.600 2.3e-03
interstitial cystitis -1.200 3.4e-04
intraductal papillary-mucinous adenoma (... 1.500 8.9e-04
intraductal papillary-mucinous carcinoma... 1.200 8.7e-03
intraductal papillary-mucinous neoplasm ... 2.100 2.8e-03
lung carcinoma -2.100 2.6e-33
osteosarcoma 4.434 2.6e-05
ovarian cancer -1.600 7.7e-07
Pick disease -1.200 2.2e-03
progressive supranuclear palsy -1.700 6.6e-03
Rheumatoid arthritis 1.900 1.7e-02
tuberculosis 1.900 4.1e-07

Gene RIF (7)

AA Sequence

MIAELVSSALGLALYLNTLSADFCYDDSRAIKTNQDLLPETPWTHIFYNDFWGTLLTHSGSHKSYRPLCT      1 - 70
LSFRLNHAIGGLNPWSYHLVNVLLHAAVTGLFTSFSKILLGDGYWTFMAGLMFASHPIHTEAVAGIVGRA     71 - 140
DVGASLFFLLSLLCYIKHCSTRGYSARTWGWFLGSGLCAGCSMLWKEQGVTVLAVSAVYDVFVFHRLKIK    141 - 210
QILPTIYKRKNLSLFLSISLLIFWGSSLLGARLYWMGNKPPSFSNSDNPAADSDSLLTRTLTFFYLPTKN    211 - 280
LWLLLCPDTLSFDWSMDAVPLLKTVCDWRNLHTVAFYTGLLLLAYYGLKSPSVDRECNGKTVTNGKQNAN    281 - 350
GHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTENIVVLSLSLLIIPFVPATNLFFYVGFVIA    351 - 420
ERVLYIPSMGFCLLITVGARALYVKVQKRFLKSLIFYATATLIVFYGLKTAIRNGDWQNEEMLYRSGIKV    421 - 490
NPAKAWGNLGNVLKSQSKISEAESAYRNALYYRSNMADMLYNLGLLLQENSRFAEALHYYKLAIGSRPTL    491 - 560
ASAYLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLGKLYHEQGHYEEALSVYK    561 - 630
EAIQKMPRQFAPQSLYNMMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLF    631 - 700
LKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDL    701 - 770
AARLRPNYPAALMNLGAILHLNGRLQKAEANYLRALQLKPDDVITQSNLRKLWNIMEKQGLKTSKT        771 - 836
//

Text Mined References (19)

PMID Year Title