Property Summary

NCBI Gene PubMed Count 21
PubMed Score 75.79
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -1.464 1.2e-03
adult high grade glioma 1.200 3.5e-03
Astrocytoma, Pilocytic 1.700 4.9e-06
atypical teratoid / rhabdoid tumor 1.300 1.3e-02
Breast cancer -1.300 2.0e-10
ependymoma 1.600 3.5e-05
glioblastoma 1.300 2.1e-04
group 3 medulloblastoma 1.300 1.0e-02
invasive ductal carcinoma 1.213 7.3e-03
lung adenocarcinoma -1.100 2.6e-08
lung carcinoma -2.700 2.8e-28
mucosa-associated lymphoid tissue lympho... 1.172 6.4e-03
nasopharyngeal carcinoma -1.500 6.9e-06
non-small cell lung cancer -1.696 5.7e-19
osteosarcoma -1.694 6.2e-03
ovarian cancer -3.900 2.1e-19
pancreatic cancer 1.300 6.6e-05
pancreatic carcinoma 1.300 6.6e-05
pancreatic ductal adenocarcinoma liver m... 1.363 1.7e-02
primitive neuroectodermal tumor 1.200 3.6e-02
psoriasis -1.200 3.8e-07
sarcoidosis 1.100 7.1e-03
subependymal giant cell astrocytoma 3.803 1.7e-02
tuberculosis and treatment for 3 months -1.200 1.2e-02
ulcerative colitis -1.100 1.3e-03

Gene RIF (10)

AA Sequence

MSWLSSSQGVVLTAYHPSGKDQTVGNSHAKAGEEATSSRRYGQYTMNQESTTIKVMEKPPFDRSISQDSL      1 - 70
DELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESIVFLSTL     71 - 140
TRTQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRESKETAPGGTESQSLRTNENKYQGRDDEASN    141 - 210
LVGEEKLIPPEETPAPETDINLEVSFAEQALNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLA    211 - 280
PQDMKKVCHLALIELTALYDVLGIELKQQKAVKIKTKDSGLFCVPLTALLEQDQRKVPGMRIPLIFQKLI    281 - 350
SRIEERGLETEGLLRIPGAAIRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYL    351 - 420
KAFQAVQNLPTKKQQLQALNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAMVMAPNLFMCH    421 - 490
ALGLKSSEQREFVMAAGTANTMHLLIKYQKLLWTIPKFIVNQVRKQNTENHKKDKRAMKKLLKKMAYDRE    491 - 560
KYEKQDKSTNDADVPQGVIRVQAPHLSKVSMAIQLTEELKASDVLARFLSQESGVAQTLKKGEVFLYEIG    561 - 630
GNIGERCLDDDTYMKDLYQLNPNAEWVIKSKPL                                         631 - 663
//

Text Mined References (26)

PMID Year Title