Property Summary

NCBI Gene PubMed Count 17
PubMed Score 65.86
PubTator Score 13.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.7966757335431E-28
non-small cell lung cancer 2798 5.72556522237953E-19
glioblastoma multiforme 347 1.15606320639565E-16
ovarian cancer 8492 1.57376214055045E-14
Breast cancer 3099 2.00603337990537E-10
lung adenocarcinoma 2714 2.55790522855384E-8
posterior fossa group B ependymoma 1530 1.29194187038175E-7
psoriasis 6685 3.7747407413361E-7
nasopharyngeal carcinoma 1056 6.92679603107574E-6
pilocytic astrocytoma 3086 2.98990749115456E-5
pancreatic carcinoma 567 6.57624430604365E-5
pancreatic cancer 2300 6.57624430604368E-5
adrenocortical carcinoma 1427 0.00122598234727972
ulcerative colitis 2087 0.001310003135179
adult high grade glioma 2148 0.00552802459316935
osteosarcoma 7933 0.00616783773380537
mucosa-associated lymphoid tissue lymphoma 480 0.00642718149085271
tuberculosis and treatment for 6 months 686 0.00679765191626034
sarcoidosis 368 0.00708361781905726
invasive ductal carcinoma 2950 0.00730822821215456
group 3 medulloblastoma 2254 0.0100614418650561
atypical teratoid / rhabdoid tumor 4369 0.012776162591709
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0171131861420105
subependymal giant cell astrocytoma 2287 0.0173221876755094
primitive neuroectodermal tumor 3031 0.0250404968678557
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0

Expression

Synonym

Accession Q8N392 E1P575 Q58EZ3 Q6P679 Q6PJD7 Q96S64
Symbols SENEX
MacGAP
bA307O14.2

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (6)

PMID Text
25425145 Results describe ARHGAP18 as a novel negative regulator of sprouting by acting dualistically to limit tip cell formation and to maintain junctional integrity.
21865595 The results define ARHGAP18 as one of the crucial factors for the regulation of RhoA for the control of cell shape, spreading, and migration.
20664062 identification of a novel gene, SENEX, that regulates stress induced premature senescence pathways in endothelial cells involving p16(INK4a) and retinoblastoma protein activation
19065146 This study use Functional MRI and Genome Wide Association Analysis indentic novel gene(ARHGAP18) associated with schizophrenia.
19065146 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWLSSSQGVVLTAYHPSGKDQTVGNSHAKAGEEATSSRRYGQYTMNQESTTIKVMEKPPFDRSISQDSL      1 - 70
DELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESIVFLSTL     71 - 140
TRTQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRESKETAPGGTESQSLRTNENKYQGRDDEASN    141 - 210
LVGEEKLIPPEETPAPETDINLEVSFAEQALNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLA    211 - 280
PQDMKKVCHLALIELTALYDVLGIELKQQKAVKIKTKDSGLFCVPLTALLEQDQRKVPGMRIPLIFQKLI    281 - 350
SRIEERGLETEGLLRIPGAAIRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYL    351 - 420
KAFQAVQNLPTKKQQLQALNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAMVMAPNLFMCH    421 - 490
ALGLKSSEQREFVMAAGTANTMHLLIKYQKLLWTIPKFIVNQVRKQNTENHKKDKRAMKKLLKKMAYDRE    491 - 560
KYEKQDKSTNDADVPQGVIRVQAPHLSKVSMAIQLTEELKASDVLARFLSQESGVAQTLKKGEVFLYEIG    561 - 630
GNIGERCLDDDTYMKDLYQLNPNAEWVIKSKPL                                         631 - 663
//

Text Mined References (22)

PMID Year Title
25778702 2015 YAP is essential for tissue tension to ensure vertebrate 3D body shape.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25425145 2014 ARHGAP18: an endogenous inhibitor of angiogenesis, limiting tip formation and stabilizing junctions.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
More...