Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
Funding $200,416.83
PubMed Score 65.86
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N392 E1P575 Q58EZ3 Q6P679 Q6PJD7 Q96S64
Symbols SENEX
MacGAP
bA307O14.2

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25425145 Results describe ARHGAP18 as a novel negative regulator of sprouting by acting dualistically to limit tip cell formation and to maintain junctional integrity.
21865595 The results define ARHGAP18 as one of the crucial factors for the regulation of RhoA for the control of cell shape, spreading, and migration.
20664062 identification of a novel gene, SENEX, that regulates stress induced premature senescence pathways in endothelial cells involving p16(INK4a) and retinoblastoma protein activation
19065146 This study use Functional MRI and Genome Wide Association Analysis indentic novel gene(ARHGAP18) associated with schizophrenia.
19065146 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWLSSSQGVVLTAYHPSGKDQTVGNSHAKAGEEATSSRRYGQYTMNQESTTIKVMEKPPFDRSISQDSL      1 - 70
DELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESIVFLSTL     71 - 140
TRTQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRESKETAPGGTESQSLRTNENKYQGRDDEASN    141 - 210
LVGEEKLIPPEETPAPETDINLEVSFAEQALNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLA    211 - 280
PQDMKKVCHLALIELTALYDVLGIELKQQKAVKIKTKDSGLFCVPLTALLEQDQRKVPGMRIPLIFQKLI    281 - 350
SRIEERGLETEGLLRIPGAAIRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYL    351 - 420
KAFQAVQNLPTKKQQLQALNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAMVMAPNLFMCH    421 - 490
ALGLKSSEQREFVMAAGTANTMHLLIKYQKLLWTIPKFIVNQVRKQNTENHKKDKRAMKKLLKKMAYDRE    491 - 560
KYEKQDKSTNDADVPQGVIRVQAPHLSKVSMAIQLTEELKASDVLARFLSQESGVAQTLKKGEVFLYEIG    561 - 630
GNIGERCLDDDTYMKDLYQLNPNAEWVIKSKPL                                         631 - 663
//

Text Mined References (22)

PMID Year Title
25778702 2015 YAP is essential for tissue tension to ensure vertebrate 3D body shape.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25425145 2014 ARHGAP18: an endogenous inhibitor of angiogenesis, limiting tip formation and stabilizing junctions.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
More...