Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
R01 Count 3
Funding $243,428.75
PubMed Score 34.44
PubTator Score 25.72

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N387 B3KY00 E9PII6 F8W945 Q6UWS3 Q8IXI8 Q8WW41 MUC-15
Symbols PAS3
MUC-15
PASIII

Gene

Gene RIF (8)

PMID Text
25573589 Frameshift mutations of MUC15 gene is associated with gastric and colorectal cancers.
24710941 Multivariate analysis suggested that MUC15 overexpression was an independent factor for prognosis (hazard risk: 3.216; P=0.009). It was concluded that MUC15 is overexpressed in glioma tissues.
23933603 MUC15 inhibits dimerization of EGFR and PI3K-AKT signaling and is associated with aggressive hepatocellular carcinomas in patients.
22657408 MUC15 is a strong candidate for eczema.
21615302 MUC4 and MUC15 were overexpressed in papillary thyroid carcinoma, and high MUC15 expression was associated with high malignant potential.
19520792 Overexpression of MUC15 activates extracellular signal-regulated kinase 1/2 and promotes the oncogenic potential of colon cancer cells.
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
17720698 MUC15 was expressed most highly in human placenta. MUC15 mRNA & protein increased with gestational age (P < 0.05, 1st versus 3rd trimester). Differential expression of MUC15 in human placentas may play critical role in regulation of trophoblast invasion.

AA Sequence

MLALAKILLISTLFYSLLSGSHGKENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKAS      1 - 70
HSPPLNLPNNSHGITDFSSNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWNAPIADEDLLPISAHPNA     71 - 140
TPALSSENFTWSLVNDTVKTPDNSSITVSILSSEPTSPSVTPLIVEPSGWLTTNSDSFTGFTPYQEKTTL    141 - 210
QPTLKFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKRKTDSFSHRRLYDDRNE    211 - 280
PVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV                    281 - 334
//

Text Mined References (18)

PMID Year Title
25573589 2015 Frameshift mutations of MUC15 gene in gastric and its regional heterogeneity in gastric and colorectal cancers.
24710941 2014 Correlations of MUC15 overexpression with clinicopathological features and prognosis of glioma.
23933603 2013 MUC15 inhibits dimerization of EGFR and PI3K-AKT signaling and is associated with aggressive hepatocellular carcinomas in patients.
22657408 2012 The ANO3/MUC15 locus is associated with eczema in families ascertained through asthma.
21615302 2011 Expression of the membrane mucins MUC4 and MUC15, potential markers of malignancy and prognosis, in papillary thyroid carcinoma.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
19520792 2009 Overexpression of MUC15 activates extracellular signal-regulated kinase 1/2 and promotes the oncogenic potential of human colon cancer cells.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
17720698 2007 Mucin 15 is expressed in human placenta and suppresses invasion of trophoblast-like cells in vitro.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...