Property Summary

NCBI Gene PubMed Count 16
PubMed Score 34.69
PubTator Score 25.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MLALAKILLISTLFYSLLSGSHGKENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKAS      1 - 70
HSPPLNLPNNSHGITDFSSNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWNAPIADEDLLPISAHPNA     71 - 140
TPALSSENFTWSLVNDTVKTPDNSSITVSILSSEPTSPSVTPLIVEPSGWLTTNSDSFTGFTPYQEKTTL    141 - 210
QPTLKFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKRKTDSFSHRRLYDDRNE    211 - 280
PVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV                    281 - 334
//

Text Mined References (18)

PMID Year Title