Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.07
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 9.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Gingival fibromatosis 14 4.571 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.341 9.6e-06

Gene RIF (1)

AA Sequence

MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSFQHPFLQAVGMFLGEFSCLAAFYLLRC      1 - 70
RAAGQSDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRL     71 - 140
VLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLR    141 - 210
AVGTEGLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAG    211 - 280
ISVTKELSATTRMVLDSLRTVVIWALSLALGWEAFHALQILGFLILLIGTALYNGLHRPLLGRLSRGRPL    281 - 350
AEESEQERLLGGTRTPINDAS                                                     351 - 371
//

Text Mined References (18)

PMID Year Title