Property Summary

NCBI Gene PubMed Count 7
PubMed Score 329.35
PubTator Score 4.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-02
atypical teratoid / rhabdoid tumor 1.300 3.1e-04
glioblastoma 1.200 2.4e-05
medulloblastoma, large-cell 1.700 2.4e-04
osteosarcoma -3.420 7.7e-10
ovarian cancer 3.100 1.3e-10
pancreatic cancer -1.100 5.5e-04

 GO Function (1)

AA Sequence

MQPTATMATAATTTTTTTATVALTTSWDNATGRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGVLLLC      1 - 70
KRCWDVHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTSSTGRRVSFNEAALF     71 - 140
EQSRKTQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVTIHECDSGEASSATTPHPATSPKATLAIFQP    141 - 210
PGKALTGRSVGPSSALPGDPYNSAAGATDFAEISPSASSDSGEGTSLDAGTRSTKAGGPGAAAGPGEAGP    211 - 280
GSGAGTVLQFLTRLRRHASLDGASPYFKVKKWKLEPSQRAASLDTRGSPKRHHFQRQRAASESTEQEEGD    281 - 350
APQEDFIQYIARAGDAVAFPHPRPFLASPPPALGRLEAAEAAGGASPDSPPERGAGSAGPEQQQPPLEPD    351 - 420
AERDAGPEQAQTSYRDLWSLRASLELHAAASDHSSSGNDRDSVRSGDSSGSGSGGAAPAFPPPSPPAPRP    421 - 490
KDGEARRLLQMDSGYASIEGRGAGDDTEPPAAPARPRSPRAWPRRPRRDYSIDEKTDALFHEFLRHDPHF    491 - 560
DDTPAAARHRARAHPHARKQWQRGRQHSDPGARAAPALAGTPAPPAGAARPARAPLRRGDSVDGPPDGRT    561 - 630
LGGAGDDPAIPVIEEEPGGGGCPGSGLCVLPSGSVLDKLAAGLDERLFPPRLAEPVVATPALVAAAPTSP    631 - 700
DHSPA                                                                     701 - 705
//

Text Mined References (11)

PMID Year Title