Property Summary

NCBI Gene PubMed Count 7
PubMed Score 317.07
PubTator Score 4.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.27907098985968E-10
osteosarcoma 7933 7.74556489507437E-10
glioblastoma 5572 2.4399533791428E-5
medulloblastoma, large-cell 6234 2.39938936018314E-4
atypical teratoid / rhabdoid tumor 4369 3.07453199078971E-4
pancreatic cancer 2300 5.51527124232523E-4
adult high grade glioma 2148 0.0124904562336716

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.420 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.700 0.000
pancreatic cancer -1.100 0.001
adult high grade glioma -1.100 0.012
ovarian cancer 3.100 0.000

Synonym

Accession Q8N350 K7EJP2 O43385
Symbols DOS
BARP
C19orf26

Gene

  Ortholog (5)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 GO Function (1)

AA Sequence

MQPTATMATAATTTTTTTATVALTTSWDNATGRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGVLLLC      1 - 70
KRCWDVHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTSSTGRRVSFNEAALF     71 - 140
EQSRKTQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVTIHECDSGEASSATTPHPATSPKATLAIFQP    141 - 210
PGKALTGRSVGPSSALPGDPYNSAAGATDFAEISPSASSDSGEGTSLDAGTRSTKAGGPGAAAGPGEAGP    211 - 280
GSGAGTVLQFLTRLRRHASLDGASPYFKVKKWKLEPSQRAASLDTRGSPKRHHFQRQRAASESTEQEEGD    281 - 350
APQEDFIQYIARAGDAVAFPHPRPFLASPPPALGRLEAAEAAGGASPDSPPERGAGSAGPEQQQPPLEPD    351 - 420
AERDAGPEQAQTSYRDLWSLRASLELHAAASDHSSSGNDRDSVRSGDSSGSGSGGAAPAFPPPSPPAPRP    421 - 490
KDGEARRLLQMDSGYASIEGRGAGDDTEPPAAPARPRSPRAWPRRPRRDYSIDEKTDALFHEFLRHDPHF    491 - 560
DDTPAAARHRARAHPHARKQWQRGRQHSDPGARAAPALAGTPAPPAGAARPARAPLRRGDSVDGPPDGRT    561 - 630
LGGAGDDPAIPVIEEEPGGGGCPGSGLCVLPSGSVLDKLAAGLDERLFPPRLAEPVVATPALVAAAPTSP    631 - 700
DHSPA                                                                     701 - 705
//

Text Mined References (11)

PMID Year Title
24751537 2014 BARP suppresses voltage-gated calcium channel activity and Ca2+-evoked exocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...