Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.74
PubTator Score 0.37

Knowledge Summary

Patent (316)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.400 1.3e-05
Astrocytoma, Pilocytic -2.200 3.3e-06
atypical teratoid / rhabdoid tumor -2.200 2.4e-05
ependymoma -2.700 8.4e-28
glioblastoma -2.200 2.4e-08
group 3 medulloblastoma -1.700 5.1e-03
medulloblastoma, large-cell -2.800 5.3e-05
primitive neuroectodermal tumor -2.800 1.5e-06

Gene RIF (1)

AA Sequence

MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYFLLSQLSLMDL      1 - 70
MYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYDRYLAICHSLYYPIRMSKMMC     71 - 140
VKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDVPAMLLLACTDTWVYEYMVFVSTSLFLLFPF    141 - 210
IGITSSCGRVLFAVYHMHSKEGRKKAFTTISTHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTIL    211 - 280
TPMLNPIIYSLRNKEVLGAMRRVFGIFSFLKE                                          281 - 312
//

Text Mined References (6)

PMID Year Title