Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.37

Knowledge Summary

Patent (316)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 8.43713747674953E-28
sonic hedgehog group medulloblastoma 1482 1.83542306485873E-7
primitive neuroectodermal tumor 3031 1.49322121012915E-6
pilocytic astrocytoma 3086 5.31455735808228E-6
glioblastoma 5572 9.92105506872427E-6
adult high grade glioma 2148 1.34955443316701E-5
atypical teratoid / rhabdoid tumor 4369 2.35618626681707E-5
medulloblastoma, large-cell 6234 5.32492471486071E-5

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -2.700 0.000
glioblastoma -2.500 0.000
sonic hedgehog group medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.800 0.000
adult high grade glioma -2.400 0.000
pilocytic astrocytoma -2.100 0.000

Synonym

Accession Q8N349 Q5VUR5
Symbols OR2L14

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG
Rat OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYFLLSQLSLMDL      1 - 70
MYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYDRYLAICHSLYYPIRMSKMMC     71 - 140
VKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDVPAMLLLACTDTWVYEYMVFVSTSLFLLFPF    141 - 210
IGITSSCGRVLFAVYHMHSKEGRKKAFTTISTHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTIL    211 - 280
TPMLNPIIYSLRNKEVLGAMRRVFGIFSFLKE                                          281 - 312
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19945174 2010 Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.