Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.86
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Salivary Gland Neoplasms 46 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
medulloblastoma, large-cell 6241 3.8e-04
osteosarcoma 7950 6.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 5.14588189883789E-4

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -1.400 5.1e-04
medulloblastoma, large-cell 1.100 3.8e-04
osteosarcoma 1.003 6.0e-04

Gene RIF (1)

AA Sequence

MAEASSLGRQSPRVVSCLEHSLCPGEPGLQTTAVVSMGSGDHQFNLAEILSQNYSVRGECEEASRCPDKP      1 - 70
KEELEKDFISQSNDMPFDELLALYGYEASDPISDRESEGGDVAPNLPDMTLDKEQIAKDLLSGEEEEETQ     71 - 140
SSADDLTPSVTSHEASDLFPNRSGSRFLADEDREPGSSASSDTEEDSLPANKCKKEIMVGPQFQADLSNL    141 - 210
HLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFN    211 - 280
VEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERY    281 - 350
DYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDG    351 - 420
LPSSEPGPCSFQQLDESPAVPLSHRPPALADPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLS    421 - 490
GDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC                   491 - 545
//

Text Mined References (8)

PMID Year Title