Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.12
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.300 6.5e-05
aldosterone-producing adenoma -1.470 1.9e-02
astrocytic glioma -2.200 2.2e-02
Astrocytoma, Pilocytic -1.300 5.3e-06
Atopic dermatitis -2.800 4.3e-05
atypical teratoid / rhabdoid tumor -5.200 1.2e-07
ependymoma -1.300 3.2e-02
glioblastoma -2.400 3.5e-05
group 3 medulloblastoma -4.300 3.2e-06
medulloblastoma, large-cell -4.100 3.1e-05
oligodendroglioma -1.600 3.3e-02
osteosarcoma 1.615 2.1e-02
periodontitis -1.400 1.5e-22
Pick disease -1.900 2.4e-02
primitive neuroectodermal tumor -2.500 1.4e-02
psoriasis -1.400 6.4e-15

Synonym

Accession Q8N336 B4E167 G5E9S5 Q9NPW3
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV      1 - 70
SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK     71 - 140
LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI    141 - 210
TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL    211 - 280
MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM                    281 - 334
//

Text Mined References (16)

PMID Year Title