Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.18
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis -1.250 7.0e-03
adult high grade glioma -1.400 9.3e-05
astrocytic glioma -1.600 8.2e-03
atypical teratoid / rhabdoid tumor -1.700 1.0e-06
Breast cancer -1.300 1.0e-03
colon cancer -1.200 1.5e-02
ependymoma -1.900 4.4e-02
glioblastoma -1.600 6.3e-06
group 4 medulloblastoma -1.900 4.2e-05
interstitial cystitis -1.400 2.1e-04
lung adenocarcinoma -1.300 4.1e-10
lung cancer -1.300 3.4e-04
malignant mesothelioma -1.500 1.2e-06
medulloblastoma, large-cell -1.500 3.0e-03
nasopharyngeal carcinoma -1.100 8.4e-05
non-small cell lung cancer -1.541 5.7e-15
osteosarcoma -1.298 1.0e-02
ovarian cancer -1.500 1.2e-04
primitive neuroectodermal tumor -1.300 8.1e-03
psoriasis -1.400 5.7e-11

Gene RIF (12)

AA Sequence

MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHK      1 - 70
LPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIRE     71 - 140
KMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFKELLQTPNFRITVVDDADTVELCGALKNIVA    141 - 210
VGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA    211 - 280
RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEH    281 - 350
T//

Text Mined References (22)

PMID Year Title