Property Summary

NCBI Gene PubMed Count 19
Grant Count 12
R01 Count 11
Funding $1,222,697.47
PubMed Score 17.21
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma -1.600 0.008
ependymoma -1.900 0.044
psoriasis -1.400 0.000
osteosarcoma -1.298 0.010
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.003
primitive neuroectodermal tumor -1.300 0.008
non-small cell lung cancer -1.541 0.000
colon cancer -1.200 0.015
lung cancer -1.300 0.000
ulcerative colitis -1.600 0.000
interstitial cystitis -1.700 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma -1.400 0.000
nasopharyngeal carcinoma -1.100 0.000
inflammatory breast cancer -1.300 0.024
ovarian cancer -1.500 0.000

Gene RIF (11)

PMID Text
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
24274692 The results of real-time PCR showed that, compared with the paired normal tissues, mRNA levels of GPD1L were decreased significantly in head and neck squamous cell carcinoma.
21685173 Common variations in or near CASQ2, GPD1L, and NOS1AP are associated with increased risk of sudden cardiac death in patients with coronary artery disease
21555452 hypoxia-induced miR-210 represses GPD1L, contributing to suppression of prolyl hydroxylases activity, and increases of HIF-1alpha protein levels.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19745168 Mutations of GPD1-L may downregulate Na(v)1.5 by altering the oxidized to reduced NAD(H) balance.
19666841 GPD1L links redox state to cardiac excitability by PKC-dependent phosphorylation of the sodium channel SCN5A.
18762705 No non-synonymous mutations were found, indicating that GPD1L does not appear to be a major cause of Brugada syndrome in a Japanese population.
18762705 Observational study of gene-disease association. (HuGE Navigator)
17967977 A GPD1-L mutation decreases SCN5A surface membrane expression, reduces inward Na+ current, and causes Brugada syndrome
More...

AA Sequence

MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHK      1 - 70
LPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIRE     71 - 140
KMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFKELLQTPNFRITVVDDADTVELCGALKNIVA    141 - 210
VGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA    211 - 280
RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEH    281 - 350
T//

Text Mined References (21)

PMID Year Title
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24274692 2014 The prognostic value of glycerol-3-phosphate dehydrogenase 1-like expression in head and neck squamous cell carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22004471 2012 Genome-wide significant association between alcohol dependence and a variant in the ADH gene cluster.
21685173 2011 Common variants in CASQ2, GPD1L, and NOS1AP are significantly associated with risk of sudden death in patients with coronary artery disease.
21555452 2011 A hypoxia-induced positive feedback loop promotes hypoxia-inducible factor 1alpha stability through miR-210 suppression of glycerol-3-phosphate dehydrogenase 1-like.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...