Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.19
PubTator Score 15.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.200 0.000

Synonym

Gene

Gene RIF (10)

PMID Text
26770020 increased gene expression of MUC16 and MUC20 was found in patients with remission ulcerative colitis
26673820 High MUC20 expression is associated wit response to chemotherapy in esophageal squamous cell carcinoma.
26616226 Results suggest that MUC20 enhances aggressive behaviors of EOC cells by activating integrin beta1 signaling and provide novel insights into the role of MUC20 in ovarian cancer metastasis.
26323930 A combination of MUC13/MUC20 expression was a potential prognostic marker for patients with ESCC, who received neoadjuvant chemotherapy followed by surgery.
25168902 MUC20 is a novel transmembrane mucin expressed by the human corneal and conjunctival epithelia, and suggest that differential expression of MUC20 during differentiation has a role in maintaining ocular surface homeostasis.
23787019 MUC20 is expressed in recurrent colorectal neoplasms and may have a role in poor outcome
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
16508246 Observational study of gene-disease association. (HuGE Navigator)
16029633 Observational study of gene-disease association. (HuGE Navigator)
15314156 Results suggest that MUC20 is a novel regulator of the Met signaling cascade which has a role in suppression of the Grb2-Ras pathway.

AA Sequence

MGCLWGLALPLFFFCWEVGVSGSSAGPSTRRADTAMTTDDTEVPAMTLAPGHAALETQTLSAETSSRAST      1 - 70
PAGPIPEAETRGAKRISPARETRSFTKTSPNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPREAIF     71 - 140
DTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDSPHPVITPSRASESSASSDGPHPVITPSR    141 - 210
ASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHP    211 - 280
VITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSAS    281 - 350
SDGLHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSWSPGSDVTLLAEALVTVTNIE    351 - 420
VINCSITEIETTTSSIPGASDTDLIPTEGVKASSTSDPPALPDSTEAKPHITEVTASAETLSTAGTTESA    421 - 490
APDATVGTPLPTNSATEREVTAPGATTLSGALVTVSRNPLEETSALSVETPSYVKVSGAAPVSIEAGSAV    491 - 560
GKTTSFAGSSASSYSPSEAALKNFTPSETPTMDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITT    561 - 630
SAKTTMKPPTATPTTARTRPTTDVSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQ    631 - 700
VSLLRVRRG                                                                 701 - 709
//

Text Mined References (26)

PMID Year Title
26770020 2015 Differential Expression of MUC12, MUC16, and MUC20 in Patients with Active and Remission Ulcerative Colitis.
26673820 2016 Possible prediction of the response of esophageal squamous cell carcinoma to neoadjuvant chemotherapy based on gene expression profiling.
26616226 2016 MUC20 promotes aggressive phenotypes of epithelial ovarian cancer cells via activation of the integrin ?1 pathway.
26323930 2015 The expression and prognostic significance of Mucin 13 and Mucin 20 in esophageal squamous cell carcinoma.
25168902 2014 Expression analysis of the transmembrane mucin MUC20 in human corneal and conjunctival epithelia.
23787019 2013 Role of MUC20 overexpression as a predictor of recurrence and poor outcome in colorectal cancer.
23625723 2013 Antitumor T cell responses in bladder cancer are directed against a limited set of antigens and are modulated by regulatory T cells and routine treatment approaches.
23262208 2013 MUC20 overexpression predicts poor prognosis and enhances EGF-induced malignant phenotypes via activation of the EGFR-STAT3 pathway in endometrial cancer.
22929560 2013 Molecular organization of the mucins and glycocalyx underlying mucus transport over mucosal surfaces of the airways.
22663354 2012 Mapping the protein domain structures of the respiratory mucins: a mucin proteome coverage study.
More...