Property Summary

NCBI Gene PubMed Count 23
PubMed Score 96.66
PubTator Score 18.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 1.5e-06
group 3 medulloblastoma 1.400 2.5e-03
invasive ductal carcinoma 1.100 4.4e-04
lung cancer 2.000 2.9e-03
osteosarcoma -1.645 3.7e-04
ovarian cancer 1.100 2.1e-03
psoriasis -1.100 3.4e-03

Gene RIF (12)

AA Sequence

MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFAR      1 - 70
HAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSEDGSKNSRQPAEAGVVESEN       71 - 138
//

Text Mined References (26)

PMID Year Title