Property Summary

NCBI Gene PubMed Count 23
Grant Count 24
R01 Count 18
Funding $2,053,920.34
PubMed Score 90.78
PubTator Score 18.79

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
24699063 The MHF complex, which is a heterotetramer that comprises two MHF1-MHF2 heterodimers, is remodeled by FANCM to favor recognition of branched DNA over dsDNA.
24522885 CENP-S is not found in a soluble complex with its binding partner CENP-T but it interacts strongly and specifically with immobilized CENP-T in an in vivo binding assay.
24390579 MHF prefers branched DNA over dsDNA because it engages two duplex arms. MHF engages DNA forks or various four-way junctions independent of the junction-site structure. The DNA-binding interface of MHF is important for cellular resistance to DNA damage.
24256282 It discusses current knowledge of the biological roles of CENP-S and CENP-X and how their dual existence may be a common feature of CCAN (constitutive centromere-associated network) proteins.
23886707 A long, positively charged patch exposed on the surface of the (MHF1-MHF2) complex plays a critical role in double-stranded DNA binding to chromatin.
22510687 MHF1 and MHF2 form a compact tetramer to which FANCM-F binds through a 'dual-V' shaped structure.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20347429 provide biochemical evidence that MHF1 and MHF2 assemble into a heterodimer that binds DNA and enhances the DNA branch migration activity of FANCM.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19620631 Results identified a centromere protein S (CENP-S)-containing subcomplex that includes the new constitutive kinetochore protein CENP-X.
More...

AA Sequence

MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFAR      1 - 70
HAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSEDGSKNSRQPAEAGVVESEN       71 - 138
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25038251 2014 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.
24699063 2014 The histone-fold complex MHF is remodeled by FANCM to recognize branched DNA and protect genome stability.
24522885 2014 A CENP-S/X complex assembles at the centromere in S and G2 phases of the human cell cycle.
24390579 2014 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
24256282 2013 Emerging roles for centromere-associated proteins in DNA repair and genetic recombination.
23886707 2013 Structural peculiarities of the (MHF1-MHF2)4 octamer provide a long DNA binding patch to anchor the MHF-FANCM complex to chromatin: a solution SAXS study.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22510687 2012 The structure of the FANCM-MHF complex reveals physical features for functional assembly.
22304917 2012 CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.
More...