Property Summary

NCBI Gene PubMed Count 68
Grant Count 45
R01 Count 33
Funding $2,549,277.62
PubMed Score 52.66
PubTator Score 61.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis 1.500 0.000
osteosarcoma 1.968 0.000
adult high grade glioma -1.100 0.002
subependymal giant cell astrocytoma -1.331 0.034
ovarian cancer 1.100 0.000

Gene RIF (41)

PMID Text
26937035 Our data reveal a novel and dynamic role for PIAS4 in the cellular-mediated restriction of herpesviruses and establish a new functional role for the PIAS family of SUMO ligases in the intrinsic antiviral immune response to DNA virus infection.
26708148 these findings provide evidence for the effects of PIAsxalpha and its mechanism on osteosarcoma progression, which offers novel insight into sumoylation and the cell cycle in osteosarcoma.
26616021 PIAS4 activity are required for the AMPKalpha1 SUMOylation and the inhibition of AMPKalpha1 activity towards mTORC1 signalling.
26116533 SUMOylation of RXRalpha is significantly enhanced through PIAS4-mediated activity.
25853300 PIAS4 was identified as a candidate gene for abnormal head size in 13 patients with proximal 19p13.3 submicroscopic rearrangements .
25234649 PIAS4 (rs735842) and VEGFA (rs699947) were the most statistically significant variants associated in hypoxia pathway analysis.
24614299 PIASgamma-dependent modification of tomosyn-1 with SUMO-2/3 presents a novel mechanism to adapt secretory strength to the dynamic synaptic environment.
24457965 High reactive oxygen speciesinduces oxidation and ubiquitin-mediated degradation of PIASgamma, thereby disrupting PIASgamma-IKKgamma cross talk.
24002598 PIAS4 was overexpressed in pancreatic cancer cells compared with normal pancreas; it interacts with the tumour suppressor von Hippel-Lindau (VHL) and leads to VHL sumoylation, oligomerization and impaired function; study elucidates role of PIAS4 in regulation of pancreatic cancer cell growth
23704280 Evidence that PIASy is the only SUMO E3 ligase that regulates lung cancer epithelial-to-mesenchymal transition (EMT) by repressing SIRT1 transcription.
More...

AA Sequence

MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKN      1 - 70
SEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFN     71 - 140
MLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPP    141 - 210
NIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLT    211 - 280
SSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDA    281 - 350
VFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA    351 - 420
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDED    421 - 490
EEGPRPKRRCPFQKGLVPAC                                                      491 - 510
//

Text Mined References (73)

PMID Year Title
26937035 2016 Novel Role for Protein Inhibitor of Activated STAT 4 (PIAS4) in the Restriction of Herpes Simplex Virus 1 by the Cellular Intrinsic Antiviral Immune Response.
26708148 2016 Protein inhibitor of activated STAT x? depresses cyclin D and cyclin D kinase, and contributes to the inhibition of osteosarcoma cell progression.
26616021 2015 SUMOylation of AMPK?1 by PIAS4 specifically regulates mTORC1 signalling.
26116533 2015 Distinct functional modes of SUMOylation for retinoid X receptor alpha.
25853300 2015 PIAS4 is associated with macro/microcephaly in the novel interstitial 19p13.3 microdeletion/microduplication syndrome.
25234649 2014 Identification of gene variants associated with hypoxia pathway in acute coronary syndrome: a pilot study.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24614299 2014 Tomosyn interacts with the SUMO E3 ligase PIAS?.
24457965 2014 ROS-PIAS? cross talk channelizes ATM signaling from resistance to apoptosis during chemosensitization of resistant tumors.
24002598 2013 PIAS4 is an activator of hypoxia signalling via VHL suppression during growth of pancreatic cancer cells.
More...