Property Summary

NCBI Gene PubMed Count 71
PubMed Score 57.04
PubTator Score 61.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-03
malignant mesothelioma 1.600 1.6e-07
osteosarcoma 1.968 2.5e-09
ovarian cancer 1.100 4.6e-05
psoriasis 1.500 1.2e-04
subependymal giant cell astrocytoma -1.331 3.4e-02

Gene RIF (43)

AA Sequence

MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKN      1 - 70
SEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFN     71 - 140
MLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPP    141 - 210
NIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLT    211 - 280
SSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDA    281 - 350
VFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA    351 - 420
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDED    421 - 490
EEGPRPKRRCPFQKGLVPAC                                                      491 - 510
//

Text Mined References (77)

PMID Year Title