Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.62
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.008 4.7e-06
non primary Sjogren syndrome sicca 1.200 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.369 4.4e-03
tuberculosis 1.200 7.1e-09

Synonym

Accession Q8N2U0
Symbols C17orf61

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLL      1 - 70
LASGTTLFCTSFYYQALSGDPSIQTLAPAGGTLLLLGWLALAL                                71 - 113
//

Text Mined References (7)

PMID Year Title