Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.43
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 7.05988192905706E-9
acute quadriplegic myopathy 1157 4.72142856564928E-6
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00440379008850314
non primary Sjogren syndrome sicca 840 0.0230355450066833
Disease Target Count Z-score Confidence
Meckel syndrome 48 3.972 2.0
Bardet-Biedl Syndrome 40 3.646 1.8

Expression

  Differential Expression (4)

Synonym

Accession Q8N2U0
Symbols C17orf61

Gene

PANTHER Protein Class (3)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

AA Sequence

MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLL      1 - 70
LASGTTLFCTSFYYQALSGDPSIQTLAPAGGTLLLLGWLALAL                                71 - 113
//

Text Mined References (6)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.