Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.574 4.2e-04
Breast cancer -1.100 7.6e-08
cystic fibrosis -1.100 5.1e-03
group 4 medulloblastoma -2.000 3.3e-07
invasive ductal carcinoma -1.149 7.1e-05
juvenile dermatomyositis 1.292 1.7e-12
ovarian cancer 1.400 9.7e-04
pituitary cancer -1.700 1.6e-06
primary pancreatic ductal adenocarcinoma 1.088 1.8e-03
psoriasis 1.500 8.1e-36
spina bifida -1.235 4.9e-02
tuberculosis -2.100 2.7e-07

Synonym

Accession Q8N2R8 A3KME2 Q8IXP4 Q8WZ07
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTY      1 - 70
TVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRMVHAEERALRRPGHLYLLHRV     71 - 140
TYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARH    141 - 210
QQQELVGAHTIPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQLEQELQEEEEEEQPEGCPE    211 - 280
EEENRAAEGDPAEEEAEAQRALVVAMHFECGDLLDTLENGRGEALGGGGGSLGPGAGPPPLLLGSASDMK    281 - 350
AELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP    351 - 420
HSG                                                                       421 - 423
//

Text Mined References (5)

PMID Year Title