Property Summary

NCBI Gene PubMed Count 8
Grant Count 22
R01 Count 22
Funding $3,116,255.14
PubMed Score 26.96
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GO Component (1)

Gene RIF (1)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT      1 - 70
EMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLS     71 - 140
PGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFR    141 - 210
RQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTD    211 - 280
IKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF                                          281 - 312
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15670784 2005 Odd-skipped related 2 splicing variants show opposite transcriptional activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175245 2004 Odd-skipped related 2 (Osr2) encodes a key intrinsic regulator of secondary palate growth and morphogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520675 2001 Osr2, a new mouse gene related to Drosophila odd-skipped, exhibits dynamic expression patterns during craniofacial, limb, and kidney development.