Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.84
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -2.800 8.1e-05
atypical teratoid / rhabdoid tumor 1.400 3.0e-02
Breast cancer -1.300 3.6e-02
diabetes mellitus -1.100 3.3e-02
ductal carcinoma in situ -1.500 7.5e-03
ependymoma 1.200 8.5e-03
head and neck cancer -1.800 1.8e-02
intraductal papillary-mucinous adenoma (... -1.800 1.0e-04
invasive ductal carcinoma -2.100 1.6e-02
lung cancer 1.100 7.4e-03
medulloblastoma, large-cell 2.000 1.9e-03
ovarian cancer -1.400 3.1e-04
psoriasis -1.900 1.3e-05
spina bifida -1.440 4.5e-02
X-linked cerebral adrenoleukodystrophy -3.200 4.9e-02

 GO Component (1)

Gene RIF (2)

AA Sequence

MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT      1 - 70
EMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLS     71 - 140
PGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFR    141 - 210
RQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTD    211 - 280
IKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF                                          281 - 312
//

Text Mined References (10)

PMID Year Title