Property Summary

NCBI Gene PubMed Count 12
PubMed Score 141.43
PubTator Score 16.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.9e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Epicondylitis 22 3.525 1.8
Pre-Eclampsia 68 3.133 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.832 1.9e-07

Gene RIF (1)

AA Sequence

MWHEARKHERKLRGMMVDYKKRAERRREYYEKIKKDPAQFLQVHGRACKVHLDSAVALAAESPVNMMPWQ      1 - 70
GDTNNMIDRFDVRAHLDHIPDYTPPLLTTISPEQESDERKCNYERYRGLVQNDFAGISEEQCLYQIYIDE     71 - 140
LYGGLQRPSEDEKKKLAEKKASIGYTYEDSTVAKVEKAAEKPEEEESAAEEESNSDEDEVIPDIDVEVDV    141 - 210
DELNQEQVADLNKQATTYGMADGDFVRMLRKDKEEAEAIKHAKALEEEKAMYSGRRSRRQRREFREKRLR    211 - 280
GRKISPPSYARRDSPTYDPYKRSPSESSSESRSRSRSPTPGREEKITFITSFGGSDEEAAAAAAAAAASG    281 - 350
VTTGKPPAPPQPGGPAPGRNASARRRSSSSSSSSSASRTSSSRSSSRSSSRSRRGGGYYRSGRHARSRSR    351 - 420
SWSRSRSRSRRYSRSRSRGRRHSGGGSRDGHRYSRSPARRGGYGPRRRSRSRSHSGDRYRRGGRGLRHHS    421 - 490
SSRSRSSWSLSPSRSRSLTRSRSHSPSPSQSRSRSRSRSQSPSPSPAREKLTRPAASPAVGEKLKKTEPA    491 - 560
AGKETGAAKPKLTPQEKLKLRMQKALNRQFKADKKAAQEKMIQQEHERQEREDELRAMARKIRMKERERR    561 - 630
EKEREEWERQYSRQSRSPSPRYSREYSSSRRRSRSRSRSPHYRH                              631 - 674
//

Text Mined References (20)

PMID Year Title