Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-35
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 1.3e-35

Synonym

Accession Q8N2M4 Q96AJ0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSATR      1 - 70
IFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLS     71 - 140
GAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAGSGALFFIISDLTIALNKFCFPVPYSRALIM    141 - 210
STYYVAQMLVALSAVESREPVEHYRLTKAN                                            211 - 240
//

Text Mined References (6)

PMID Year Title