Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.75
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 3801 1.3e-04
ovarian cancer 8520 2.4e-04
group 3 medulloblastoma 4104 1.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-04
group 3 medulloblastoma 1.100 1.4e-03
ovarian cancer 1.400 2.4e-04

Gene RIF (2)

AA Sequence

MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPRE      1 - 70
FPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKR     71 - 140
QLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAP    141 - 210
GAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE                         211 - 259
//

Text Mined References (14)

PMID Year Title