Property Summary

Ligand Count 2
NCBI Gene PubMed Count 15
PubMed Score 18.29
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Obesity 678
Disease Target Count Z-score Confidence
Cataract 297 3.786 1.9
Neuropathy 261 0.0 4.0

Expression

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL      1 - 70
RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV     71 - 140
WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD    141 - 210
SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE    211 - 280
EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP    281 - 350
ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH                          351 - 398
//

Text Mined References (18)

PMID Year Title