Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.79
PubTator Score 9.67

Knowledge Summary

Patent (762)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 2.9e-03

Gene RIF (4)

AA Sequence

MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTL      1 - 70
EERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLV     71 - 140
LDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKLGNMVLNKRTH    141 - 210
RITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQ    211 - 280
ELFRKIKAAEYTIPEDGRVSENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPD    281 - 350
IDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPM    351 - 420
TSLDTAILAQRYLRK                                                           421 - 435
//

Text Mined References (20)

PMID Year Title