Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.87
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 2.2e-06
astrocytic glioma -1.200 9.4e-03
Astrocytoma, Pilocytic -1.300 6.1e-06
atypical teratoid / rhabdoid tumor -2.000 4.6e-09
ependymoma -1.300 2.6e-02
glioblastoma -1.500 4.0e-08
group 4 medulloblastoma -1.200 8.9e-05
medulloblastoma, large-cell -1.800 1.8e-04
osteosarcoma -1.048 2.1e-04
ovarian cancer 1.300 2.2e-05
primitive neuroectodermal tumor -1.500 5.6e-04

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLGCCEEGGEETEAQRGEVTGP      1 - 70
RAHSCYNGCLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIV     71 - 140
EYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDA    141 - 210
SSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKL    211 - 280
VENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTA    281 - 350
PDKQQPWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGH    351 - 420
VCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD                         421 - 469
//

Text Mined References (19)

PMID Year Title