Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.87
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 0.009
ependymoma -1.600 0.000
osteosarcoma -1.048 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.500 0.001
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.300 0.000
ovarian cancer 1.300 0.000

Synonym

Gene

Gene RIF (5)

PMID Text
26310831 Pellino-3 is involved in endotoxin tolerance and functions as a negative regulator of Toll-like receptor 2/4 signaling.
25027698 Peptide PEL3 derived from the interleukin-1 receptor-associated kinase (IRAK)1-binding motif reveals a distinct phosphothreonine peptide binding preference.
23892723 Our findings identify RIP2 as a substrate for Pellino3 and Pellino3 as an important mediator in the Nod2 pathway and regulator of intestinal inflammation.
18326498 suggest that Pellino 3b acts as a negative regulator for IL-1 signaling by regulating IRAK degradation through its ubiquitin protein ligase activity [Pellino 3b]
15917247 Pellino3 is a novel upstream regulator of p38 MAPK that activates CREB in a p38-dependent manner

AA Sequence

MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLGCCEEGGEETEAQRGEVTGP      1 - 70
RAHSCYNGCLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIV     71 - 140
EYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDA    141 - 210
SSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKL    211 - 280
VENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTA    281 - 350
PDKQQPWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGH    351 - 420
VCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD                         421 - 469
//

Text Mined References (17)

PMID Year Title
26310831 2015 Pellino-3 promotes endotoxin tolerance and acts as a negative regulator of TLR2 and TLR4 signaling.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25027698 2014 The pellino e3 ubiquitin ligases recognize specific phosphothreonine motifs and have distinct substrate specificities.
24113711 2013 Pellino3 targets RIP1 and regulates the pro-apoptotic effects of TNF-?.
23892723 2013 Pellino3 ubiquitinates RIP2 and mediates Nod2-induced signaling and protective effects in colitis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
18326498 2008 Pellino 3b negatively regulates interleukin-1-induced TAK1-dependent NF kappaB activation.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...