Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.30
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.009 4.6e-04
Astrocytoma, Pilocytic 1.700 9.1e-07
atypical teratoid / rhabdoid tumor -2.800 1.6e-08
breast carcinoma -1.300 6.3e-22
colon cancer -1.800 6.4e-04
ductal carcinoma in situ -1.200 8.6e-03
group 3 medulloblastoma -2.800 1.8e-05
intraductal papillary-mucinous adenoma (... -1.500 9.5e-03
intraductal papillary-mucinous carcinoma... -2.200 1.2e-03
intraductal papillary-mucinous neoplasm ... -2.400 6.5e-03
invasive ductal carcinoma -2.400 4.0e-04
lung adenocarcinoma -1.082 6.0e-06
lung cancer -1.300 1.9e-02
medulloblastoma, large-cell -3.000 5.7e-06
oligodendroglioma 1.600 2.6e-02
osteosarcoma -1.766 9.8e-03
ovarian cancer -2.600 8.4e-13
pancreatic cancer 1.500 1.1e-02
pancreatic ductal adenocarcinoma liver m... -1.156 2.4e-02
pituitary cancer -1.700 4.2e-08
primitive neuroectodermal tumor -1.400 4.9e-02
psoriasis -1.300 2.5e-04
ulcerative colitis 1.400 4.3e-04

Synonym

Accession Q8N2G6 Q5U5T9 Q8TAG0
Symbols Z3CXXC8
C10orf56

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSS      1 - 70
YLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNK     71 - 140
GHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKP    141 - 210
DGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ                                           211 - 241
//

Text Mined References (11)

PMID Year Title