Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.30
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 6.29386947067738E-22
ovarian cancer 8492 3.87130246065908E-13
atypical teratoid/rhabdoid tumor 1095 1.10363975945671E-10
pituitary cancer 1972 8.77535620696941E-8
pilocytic astrocytoma 3086 1.02371435010936E-6
medulloblastoma, large-cell 6234 5.6801111332525E-6
lung adenocarcinoma 2714 5.9779886653253E-6
group 3 medulloblastoma 2254 7.40226157374756E-6
osteosarcoma 7933 7.50823857057579E-5
primary pancreatic ductal adenocarcinoma 1271 1.28237903702559E-4
psoriasis 6685 2.52991970181025E-4
invasive ductal carcinoma 2950 3.98470403195028E-4
ulcerative colitis 2087 4.2614976665771E-4
adrenocortical carcinoma 1427 4.5606710957406E-4
lung cancer 4473 4.60621070223312E-4
colon cancer 1475 6.41072928262408E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0012299755153761
pancreatic cancer 2300 0.00155174027691988
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0065294125307223
ductal carcinoma in situ 1745 0.00856401643634326
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00946813439840534
oligodendroglioma 2849 0.0255029576931836
primitive neuroectodermal tumor 3031 0.0486219754310909
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 27 3.493 1.7
Disease Target Count
Frontotemporal dementia 47

Expression

Synonym

Accession Q8N2G6 Q5U5T9 Q8TAG0
Symbols Z3CXXC8
C10orf56

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSS      1 - 70
YLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNK     71 - 140
GHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKP    141 - 210
DGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ                                           211 - 241
//

Text Mined References (11)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...