Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $249,983
PubMed Score 51.53
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.100 0.001
breast carcinoma 1.100 0.000
pancreatic carcinoma 1.100 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q8N2F6 A8K703 B4DWJ8 F5GX65 Q75K91 Q75MG6 Q75ML8 Q8IZC1 Q8IZC2 Q8IZC3 Q9BTM6
Symbols SVH
PNAS112
PNAS-112
PSEC0198

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12839973 a novel gene SVH, up-regulated in hepatocellular carcinoma, was identified; four variants SVH-A, -B, -C, and -D, resulting from alternative splicing in the coding region of the SVH transcript, were observed and localized in the endoplasmic reticulum

AA Sequence

MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAGALEEGTSEGQLCGRSARPQTGGT      1 - 70
WESQWSKTSQPEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGI     71 - 140
PIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYISQVCEDVFSGPLNSAVQLAGLTLLTNMTVTN    141 - 210
DHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRV    211 - 280
LTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI           281 - 343
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...