Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.56
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sickle Cell Anemia 53 3.96 2.0

Gene RIF (23)

AA Sequence

MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALV      1 - 70
VKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKK     71 - 140
DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAP    141 - 210
PRRSGALPPAPAAPRPALRAQRAGPAGPGAKG                                          211 - 242
//

Text Mined References (41)

PMID Year Title