Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.66
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sickle Cell Anemia 54 3.943 2.0

Gene RIF (17)

PMID Text
26008602 Plasma salusin-alpha and salusin-beta levels are increased in endometrioma patients and positively correlated with endometrioma size.
25730454 Serum salusin-Beta levels were associated with the presence and severity of coronary artery disease.
25210730 Salusin-beta but not saluin-alpha is able to promote inflammatory responses in human umbilical vein endothelial cells.
25063054 circulating salusin-beta levels are suppressed following physiological parasympathetic stimulation and appear to constitute a negative feedback relationship with the parasympathetic nervous system
24881665 Salusin-beta is an antimicrobial peptide with potent antibacterial activity against Gram-positive microorganisms.
24621517 the mechanism of salusins in atherosclerosis
24098553 Human circulating salusin-beta, is a potent hemodynamics and atherogenesis regulator.
22884920 The Salusin-alpha, salusin-beta are locally synthesized in the arteries and veins and might be important markers in the cardiopulmonary bypass.
22827297 Salusins, newly identified regulators of hemodynamics and mitogenesis, are increased within the serum of women with polycystic ovary syndrome.
22533552 There was no positive relationship between serum salusin-alpha and salusin-beta levels and preeclampsia.
20684826 Salusin-beta accelerates the development of atherosclerotic lesions in APOE knockout mice whilst salusin-alpha exerts anti-atherosclerotic effects.
19761814 Our results suggest that the interaction of tyrosine hydroxylase and mutant torsinA may contribute to the phenotype and reported dopaminergic dysfunction in torsinA-mediated dystonia.
18804130 salusin-alpha is biosynthesized and released from human-derived cells.
18497465 Decrease in serum salusin-alpha, an anti-atherogenic peptide, may be associated with carotid atherosclerosis in hypertensive patients.
18187620 Knockdown of torsin family 2, member A (TOR2A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16697365 Human salusin beta is a surrogate ligand of mouse MrgA1.
12910263 the identification and characterization of two related peptides of 28 and 20 amino acids, which we designated salusin-alpha and salusin-beta. Salusins are translated from an alternatively spliced mRNA of TOR2A

AA Sequence

MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALV      1 - 70
VKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKK     71 - 140
DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAP    141 - 210
PRRSGALPPAPAAPRPALRAQRAGPAGPGAKG                                          211 - 242
//

Text Mined References (35)

PMID Year Title
26008602 2015 Serum salusins levels are increased and correlated positively with cyst size in ovarian endometrioma.
25730454 2015 Serum salusin-? levels are associated with the presence and severity of coronary artery disease.
25210730 2014 Salusin-?, but not salusin-?, promotes human umbilical vein endothelial cell inflammation via the p38 MAPK/JNK-NF-?B pathway.
25063054 2014 Physiological fluctuations of human plasma total salusin-?, an endogenous parasympathomimetic/proatherosclerotic peptide.
24881665 2014 Salusin-?, an antimicrobially active peptide against Gram-positive bacteria.
24621517 2014 Salusin-? not salusin-? promotes vascular inflammation in ApoE-deficient mice via the I-?B?/NF-?B pathway.
24098553 2013 Circulating levels of human salusin-?, a potent hemodynamic and atherogenesis regulator.
22884920 2012 The bioactive peptides salusins and apelin-36 are produced in human arterial and venous tissues and the changes of their levels during cardiopulmonary bypass.
22827297 2013 Salusins, newly identified regulators of hemodynamics and mitogenesis, increase in polycystic ovarian syndrome.
22533552 2012 Serum levels of apelin, salusin-alpha and salusin-beta in normal pregnancy and preeclampsia.
21476293 2011 [Physicochemical characteristics of salusin-beta and establishment of the radioimmunoassay].
21185876 2011 Serum salusin-alpha level in rheumatoid arthritis.
20684826 2010 Chronic infusion of salusin-alpha and -beta exerts opposite effects on atherosclerotic lesion development in apolipoprotein E-deficient mice.
20346378 2010 Serum levels and urinary excretion of salusin-alpha in renal insufficiency.
20176058 2010 Release of salusin-beta from human monocytes/macrophages.
20015956 2010 Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA.
19761814 2009 Mutant torsinA interacts with tyrosine hydroxylase in cultured cells.
19660505 2009 Presence of immunoreactive salusin-beta in human plasma and urine.
19540434 2009 Expression of prosalusin in human neuroblastoma cells.
18804130 2008 Biosynthesis and secretion of salusin-alpha from human cells.
18497465 2008 Serum salusin-alpha levels are decreased and correlated negatively with carotid atherosclerosis in essential hypertensive patients.
16697365 2006 Salusin beta is a surrogate ligand of the mas-like G protein-coupled receptor MrgA1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12910263 2003 Salusins: newly identified bioactive peptides with hemodynamic and mitogenic activities.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644435 1999 The TOR1A (DYT1) gene family and its role in early onset torsion dystonia.
9288096 1997 The early-onset torsion dystonia gene (DYT1) encodes an ATP-binding protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.