Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.66
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sickle cell anemia 35 3.943 2.0

Synonym

Accession Q8N2E6
Symbols TORP1

Gene

Gene RIF (17)

PMID Text
26008602 Plasma salusin-alpha and salusin-beta levels are increased in endometrioma patients and positively correlated with endometrioma size.
25730454 Serum salusin-Beta levels were associated with the presence and severity of coronary artery disease.
25210730 Salusin-beta but not saluin-alpha is able to promote inflammatory responses in human umbilical vein endothelial cells.
25063054 circulating salusin-beta levels are suppressed following physiological parasympathetic stimulation and appear to constitute a negative feedback relationship with the parasympathetic nervous system
24881665 Salusin-beta is an antimicrobial peptide with potent antibacterial activity against Gram-positive microorganisms.
24621517 the mechanism of salusins in atherosclerosis
24098553 Human circulating salusin-beta, is a potent hemodynamics and atherogenesis regulator.
22884920 The Salusin-alpha, salusin-beta are locally synthesized in the arteries and veins and might be important markers in the cardiopulmonary bypass.
22827297 Salusins, newly identified regulators of hemodynamics and mitogenesis, are increased within the serum of women with polycystic ovary syndrome.
22533552 There was no positive relationship between serum salusin-alpha and salusin-beta levels and preeclampsia.
More...

AA Sequence

MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALV      1 - 70
VKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKK     71 - 140
DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAP    141 - 210
PRRSGALPPAPAAPRPALRAQRAGPAGPGAKG                                          211 - 242
//

Text Mined References (35)

PMID Year Title
26008602 2015 Serum salusins levels are increased and correlated positively with cyst size in ovarian endometrioma.
25730454 2015 Serum salusin-? levels are associated with the presence and severity of coronary artery disease.
25210730 2014 Salusin-?, but not salusin-?, promotes human umbilical vein endothelial cell inflammation via the p38 MAPK/JNK-NF-?B pathway.
25063054 2014 Physiological fluctuations of human plasma total salusin-?, an endogenous parasympathomimetic/proatherosclerotic peptide.
24881665 2014 Salusin-?, an antimicrobially active peptide against Gram-positive bacteria.
24621517 2014 Salusin-? not salusin-? promotes vascular inflammation in ApoE-deficient mice via the I-?B?/NF-?B pathway.
24098553 2013 Circulating levels of human salusin-?, a potent hemodynamic and atherogenesis regulator.
22884920 2012 The bioactive peptides salusins and apelin-36 are produced in human arterial and venous tissues and the changes of their levels during cardiopulmonary bypass.
22827297 2013 Salusins, newly identified regulators of hemodynamics and mitogenesis, increase in polycystic ovarian syndrome.
22533552 2012 Serum levels of apelin, salusin-alpha and salusin-beta in normal pregnancy and preeclampsia.
More...