Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.120247013021E-18
ovarian cancer 8492 3.96497629357013E-4
Disease Target Count Z-score Confidence
Myopia 99 3.406 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q8N2C3 Q496C8 Q96BW0
Symbols DEP.4

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Chimp OMA EggNOG Inparanoid
Opossum OMA EggNOG
Xenopus OMA EggNOG

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MVPGEEPARELMAVLLTPRFRRLVSQNELPGPGLNGPSSRNRRDGFCRKRRTGCSGPFQATQLWDGIIHS      1 - 70
LQAQVEIKRRRHHLQTYKDCFTGSDAVDVVLSHLMQNTCLSSNDISCLKGVHLCQVLMNHKVFEPVGMKK     71 - 140
LFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIGEERIEELIHT    141 - 210
INGNPALCPNITVQKPFLRLSKEDVWKEQTLLCLLQLIHLPFLDNILEPPVKTQNLQLNKEEDLVITNTC    211 - 280
LDRELIPSLCLPEK                                                            281 - 294
//

Text Mined References (5)

PMID Year Title
23422819 2013 Association mapping of the high-grade myopia MYP3 locus reveals novel candidates UHRF1BP1L, PTPRR, and PPFIA2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.